CAZyme Information: CDH56879.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH56879.1
• CAZy Family: GT2
• CAZyme Description: glycosyltransferase family 49 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515	CBTN010000041|CGC2	58040.43	7.6067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000041:276899-278683(+)

Full Sequence      

MGAMTAALDSISLDENPSAARSRNRAPSLSTACPPAGVVRPPTTTSSPGSRVGADPFHNA
SQLCKRLFRLRITRLLAWGYLAISMIVFTLHLPSLTYKYNHQHSASSSTPGLKTTTLLQN
VNSQTLISSSSHGSSSSSSSSSSPIDELSYQLRLSKMFSKSLGRMDHLRPHWFSATVDPD
PQSLTLATVLTMDEWPNLIRLAEQWEGPISAALQIPTDGTNLGSGTMLQHLSSIRRHYDT
NPTLARNVDLHLIARPTSGNDGRIRTGQQDARNLARLFARSRYVAHIPVTTLWMTNLTAA
VSTYLDRLDAGDLLIVPTFAFPKSSNRKIATIAFGMEEEYHWPTNKAEMVEWVDDNRMGI
LDYHWNLNTGPTSYTLWREASEPYLVPNYDYHYSPVYIATRDDHPWCEERFMDEPSACLY
STYLNGANLWVLPNDYIVRTGQEPENKLTMDERILQLKLYKNYRIEQCVFYARQFDQVST
FSTEQSDHIQQECVKELGSLRRQKMISSALSKSHH

Enzyme Prediction     

No EC number prediction in CDH56879.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	176	446	1.2e-16	0.744807121661721

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	3.10e-14	183	434	1	285	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14416.1|GT49	0.0	4	515	1	498
CDS06192.1|GT49	3.10e-193	28	508	32	486
CDS11928.1|GT49	4.33e-67	143	493	157	494
CDS07474.1|GT49	9.00e-66	143	493	173	509
CDS06217.1|GT49	1.43e-49	145	495	89	423

PDB Hits     

CDH56879.1 has no PDB hit.

Swiss-Prot Hits     

CDH56879.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000003

TMHMM  Annotations     

Start	End
75	97