CAZyme Information: CDH56208.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH56208.1
• CAZy Family: GT15
• CAZyme Description: glycoside hydrolase family 25 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224		24625.65	4.8036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000035:321787-322648(-)

Full Sequence      

MKNLIFGISLLASAFISTQAANTGVDVSALVSTDSWSCAKNYGYSHAIIRCYFEAWGGNP
GGALDNSCAKNYANAVAGGFDQIDLYMFPCTGRSTCKSPAAQVNEMVDHMKSNKMKIDTL
WLDVEVDPQSNNWPSASQAQSELKEFKAAFDATGLKWGVYASQSQWTSITGSKDWVLDSS
VPLWYAHYDEDLSFDDFSPFGGWTKPAIKVGIERMHMHDMVPIT

Enzyme Prediction     

EC	3.2.1.17:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	25	195	5e-16	0.8531073446327684

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119378	GH25_Lys1-like	1.90e-62	24	209	3	178	Lys-1 is a lysozyme encoded by the Caenorhabditis elegans lys-1 gene. This gene is one of a several lysozyme genes upregulated upon infection by the Gram-negative bacterial pathogen Serratia marcescens. Lys-1 contains a glycosyl hydrolase family 25 (GH25) catalytic domain. This family also includes Lys-5 from Caenorhabditis elegans.
119373	GH25_muramidase	9.55e-15	24	204	2	164	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
119376	GH25_LytC-like	6.31e-11	24	203	3	170	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
395941	Glyco_hydro_25	1.84e-05	25	189	1	153	Glycosyl hydrolases family 25.
119385	GH25_Lyc-like	3.08e-04	24	191	2	150	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS02619.1|GH25	3.44e-142	1	209	1	209
QNJ46208.1|GH25|3.2.1.17	2.30e-101	17	209	17	210
QNJ46226.1|GH25|3.2.1.17	2.52e-94	1	209	1	213
QNJ46258.1|GH25|3.2.1.17	6.18e-43	1	207	5	207
QNJ46257.1|GH25|3.2.1.17	1.74e-42	1	205	1	205

PDB Hits     

CDH56208.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q86KC1|LYSG2_DICDI	4.01e-37	8	209	4	193	Probable GH family 25 lysozyme 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274181 PE=3 SV=1
sp|Q20967|LYS5_CAEEL	5.95e-34	1	208	1	194	Lysozyme-like protein 5 OS=Caenorhabditis elegans OX=6239 GN=lys-5 PE=2 SV=1
sp|Q54BL8|LYSG5_DICDI	2.41e-33	21	209	20	197	Probable GH family 25 lysozyme 5 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293566 PE=3 SV=1
sp|Q27650|LYS4_ENTHI	2.22e-29	24	209	3	179	Lysozyme OS=Entamoeba histolytica OX=5759 GN=LYS4 PE=1 SV=2
sp|Q54BQ8|LYSG4_DICDI	3.24e-29	21	209	19	193	Probable GH family 25 lysozyme 4 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293492 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999765	CS pos: 20-21. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in CDH56208.1.