CAZyme Information: CDH56159.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH56159.1
• CAZy Family: GT15
• CAZyme Description: beta galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
974		109082.21	4.4064

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000035:205079-208536(-)

Full Sequence      

MVARGVLTSVSMAIMAVATAAAPLVSLEKREESNNGLTDRVTWDKHSLLIDGERLFFFSG
EFHYYRLPSPSLWFDVMEKFKALEFNGVSFYFNWGYHSPKKGVYDFDGVRDVQKAFDAAA
AADLHVITRAGPYINAEVDCGGFPGWLMNQHSMARKSSPENDANSKEWLEAIDKYIVPNQ
ITKGGRVVLNQIDNEYADNVDPYYMEMIKQKFAEDGVDVPSIFNDPNTNGYFAHGTGSVD
IYGWDSYPLGFDCSNPTVWPNNRSTTWRDYHEMMNPGEPMALYEFQGGAFDPWGGPGYDA
CRTMVNEQYAKVFYKNNYAQGATIQNLYMGYGGSSWGGLAKPTVYTSYDYGAPISEPGLM
TPKGYEVKLQGTFLHTVKPFWTTEHFSPKVDKDDIILVDGLADVNTDTKFYIAQHWNTAS
EDKDEFHIDIETSDGKFTIPQKNKLVIDGREAKILTTDYDFHSQHLVYTTSEIFTHQTMG
SHDVMVVYAYEDQEGEFALKVSKDDVKVDAKDDSVSHSVEDGILLINYKHTNGTTPIYIS
GGSDQDLLLLVAGYSSATRWWAPIVKDSKDRVLIQGPYLVRGASISDSTLAFTGDIDETT
DIEVVVPENIESFTWNDKELKLKKSEHGTWTGTIEFKDPKIDIPDLTKAEWKYSEASPEI
NPDFDDSTWTTANHLQTNSVTIPETWPILFADDYGFHTGCIWLRGKFNGSSDITGFNLTA
VSGDASAWVAWLNGEYLGGYDVGNQAFEDLNGTLKTDGENVISLLLWTTGHEDDWSADDD
YKTARGFQKANLLGTRNQTIWSIDWKIQGNLGGEDLADPVRGPYNEGGLYGERMGWHLPG
FDDGDWDKVSVPEDKNRTGVSWYRTNFDLDIPDGYDAPMSIKFDDDTKTRYRALLFINGW
QFGRYANDLGPQTQYYLPSGILNTKGSNTLAVAVIPIDKGAQLGKVILEPYKVLESSIPA
VELVDSPGIDKRQT

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	48	369	3e-84	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.46e-81	47	369	1	313	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	1.18e-35	401	557	24	178	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	6.61e-32	830	934	1	105	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404273	BetaGal_dom3	4.73e-25	568	631	2	65	Beta-galactosidase, domain 3. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain has an Ig-like fold.
198097	BetaGal_dom2	6.51e-24	393	559	17	181	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS02643.1|GH35	0.0	12	974	1	948
UPG88513.1|GH35	4.78e-241	41	948	42	942
UPG93009.1|GH35	1.95e-239	41	948	39	939
URZ04686.1|GH35	3.62e-235	38	968	56	970
AHH95940.1|CBM51|GH35	4.37e-235	41	973	46	967

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IFP_A	5.38e-207	41	973	46	1004	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.51e-206	41	973	46	1004	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
1TG7_A	9.61e-206	41	973	6	968	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
4IUG_A	5.20e-198	37	973	42	1002	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	1.93e-197	31	972	16	999	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QAN3|BGALA_ASPNC	2.32e-206	41	973	46	1004	Beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1
sp|Q700S9|BGALA_PENSQ	1.61e-204	41	973	46	1008	Beta-galactosidase A OS=Penicillium sp. OX=5081 GN=lacA PE=1 SV=1
sp|Q4ZHV7|BGALA_ASPPH	2.01e-204	41	973	46	1004	Probable beta-galactosidase A OS=Aspergillus phoenicis OX=5063 GN=lacA PE=2 SV=1
sp|Q2UMD5|BGALC_ASPOR	6.31e-203	33	951	24	957	Probable beta-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacC PE=3 SV=1
sp|B8N2I5|BGALC_ASPFN	1.25e-202	33	951	24	957	Probable beta-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.501444	0.498544

TMHMM  Annotations     

Start	End
5	27