CAZyme Information: CDH55922.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH55922.1
• CAZy Family: GT15
• CAZyme Description: glycoside hydrolase family 18 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	CBTN010000033|CGC1	58897.74	6.7464

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000033:302824-305107(+)

Full Sequence      

MCIYLVSIGSHLSLPNAHNAHNLATSIAGADHSICFPDWGQNSYGAANPTDKKNWQQPLR
HYCEDDSIDVLPVSFLTTFFSTGGKPTINLANYCNSVDNSTFPGTQLADCSGMEDDIRYC
QQRGKAITLSLGGATGGVGFSSDDQANAFADTLWNDFLGGSSSTRPFGNVSLDGIDLDIE
GGGAAHYPVFLRKLKTYFDGADKKYYITAAPQCVFPDANLQQTMNDFPMDAVYVQFCKYH
VSGNFLQLMLGIIDNNPCGLQTYGKASQWNFGMWDHWARNVSPNKDVKIYIGAPASSSAA
GGGYVPLATLAKIVNDTRHSFPSFGGVMYWGTTIQNYASQARANGRMDSGIKGIMGNTCN
GGFEYPPCDAPTWDHSGRLYTAGNRVSHKYIWEAKWSASAEPKANPMGEWAPVKACQANG
TPPNIPSIPIHQSQPSSASISTQKPVPSTSSKADTSNTMNNAPPPPSVKPTSLGTPNATT
ATPTPLPPQTAQAQPTGNPCNTLPLWSPSSAYIGGSKVVYQQKVWSAAWWTYGDVPGGAA
GVWSMEKACP

Enzyme Prediction     

EC	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	57	322	4.1e-19	0.6554054054054054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	4.21e-92	39	353	7	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	9.50e-17	115	318	54	237	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	1.76e-16	66	330	26	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
213178	ChiC_BD	2.78e-11	504	543	1	40	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
197760	ChtBD3	1.28e-08	506	543	4	41	Chitin-binding domain type 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06792.1|CBM5|GH18	3.01e-306	39	550	30	523
CDS02783.1|GH18	9.61e-154	39	389	11	340
QRV75888.1|CBM5|GH18	2.63e-147	39	549	36	480
QRV90694.1|CBM5|GH18	1.05e-146	39	549	36	480
EAU93428.2|CBM5|GH18|3.2.1.14	3.28e-143	39	549	31	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	9.97e-54	39	344	12	272	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	1.20e-47	39	330	7	253	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]
1HVQ_A	2.54e-43	39	330	7	255	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]
1KR0_A	2.52e-42	39	330	7	255	Chain A, Hevamine A [Hevea brasiliensis]
1KQY_A	1.80e-41	39	330	7	255	Chain A, Hevamine A [Hevea brasiliensis],1KQZ_A Chain A, Hevamine A [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29026|CHI1_RHIOL	3.52e-68	39	420	35	372	Chitinase 1 OS=Rhizopus oligosporus OX=4847 GN=CHI1 PE=1 SV=1
sp|P29027|CHI2_RHIOL	1.40e-67	39	355	35	311	Chitinase 2 OS=Rhizopus oligosporus OX=4847 GN=CHI2 PE=1 SV=1
sp|P29025|CHI1_RHINI	9.87e-65	39	355	33	308	Chitinase 1 OS=Rhizopus niveus OX=4844 GN=CHI1 PE=3 SV=1
sp|Q5AAH2|CHI1_CANAL	6.31e-54	23	330	9	270	Chitinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT1 PE=1 SV=1
sp|P46876|CHI1_CANAX	6.31e-54	23	330	9	270	Chitinase 1 OS=Candida albicans OX=5476 GN=CHT1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999574	0.000446

TMHMM  Annotations     

There is no transmembrane helices in CDH55922.1.