CAZyme Information: CDH55749.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH55749.1
• CAZy Family: GT1
• CAZyme Description: alpha--n-acetylglucosaminyltransferase extl3isoform 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529		60562.79	6.0470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000032:259910-261862(-)

Full Sequence      

MVCSVAYIIRPLSIPPPVSSPSSTPAVVSMEQQQPMGDYFLDKAYVTIIHNELEIDPAKV
ALYSLYKTHPQARIVAIIPDTFSEDNATSIQSIGLNTAVIKAPSASSSATLDTTEIWNFV
PTTLEKLLYFSTEIMFQKNVDHYFGYVAHTVLKKDAAIGLKVLERGEQTSSSSLLIPETF
PMADQEVFWFHGPMKPWNAHQYHGIDWQTHYNPLPFYHWRHLHDELAFSNKGETAQWINQ
DRRRLLCDDASSTMMSPKNNIDQFTVLLSTYNPERIQHLQLLIQHLLQSTQAHKIFVTWH
NPHLDVPDALLQMGERVTILQQSYDSLNNRFNPINAIETEAVYIIDDDVLVDIQDIEFTF
EVWRLNKDSIVGHFPRLHGYNPETHKGSYRVPKDDEAYSMILTKSMFARTDYLFTYTCLL
DKELHHIIDERTNCEDIAFNMMVSGMTGAKSIAVIPSKPMIDYGGKKGISTNNHHMEERR
ECAGRFITEYWDAVDPLIMSHSAVVRRVGPQIQKGRWENMQADLHSSFV

Enzyme Prediction     

No EC number prediction in CDH55749.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT64	264	491	5.6e-59	0.9314516129032258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401264	Glyco_transf_64	1.77e-45	264	486	1	223	Glycosyl transferase family 64 domain. Members of this family catalyze the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.
133018	GT8_Glycogenin	0.002	44	144	2	110	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12929.1|GT64	7.78e-266	62	526	1	454
BAM79674.1|GT64|GT8	4.75e-50	187	520	364	733
NP_565236.1|GT64	6.87e-35	249	511	33	314
AAG52433.1|GT64	6.87e-35	249	511	33	314
ABD59059.1|GT64	6.87e-35	249	511	33	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7AU2_A	4.08e-28	262	490	632	858	Chain A, Exostosin-like 3 [Homo sapiens],7AU2_B Chain B, Exostosin-like 3 [Homo sapiens],7AUA_A Chain A, Exostosin-like 3 [Homo sapiens],7AUA_B Chain B, Exostosin-like 3 [Homo sapiens]
1OMX_A	2.81e-25	258	490	24	267	Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) [Mus musculus],1OMX_B Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) [Mus musculus],1OMZ_A crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) in complex with UDPGalNAc [Mus musculus],1OMZ_B crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) in complex with UDPGalNAc [Mus musculus],1ON6_A Crystal structure of mouse alpha-1,4-N-acetylhexosaminotransferase (EXTL2) in complex with UDPGlcNAc [Mus musculus],1ON6_B Crystal structure of mouse alpha-1,4-N-acetylhexosaminotransferase (EXTL2) in complex with UDPGlcNAc [Mus musculus],1ON8_A Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) with UDP and GlcUAb(1-3)Galb(1-O)-naphthalenelmethanol an acceptor substrate analog [Mus musculus],1ON8_B Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) with UDP and GlcUAb(1-3)Galb(1-O)-naphthalenelmethanol an acceptor substrate analog [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C975|GT643_ARATH	1.22e-35	249	511	33	314	Glycosyltransferase family protein 64 C3 OS=Arabidopsis thaliana OX=3702 GN=At1g80290 PE=2 SV=1
sp|P70428|EXT2_MOUSE	6.97e-28	264	490	456	684	Exostosin-2 OS=Mus musculus OX=10090 GN=Ext2 PE=1 SV=2
sp|O77783|EXT2_BOVIN	9.33e-28	264	490	456	684	Exostosin-2 OS=Bos taurus OX=9913 GN=EXT2 PE=1 SV=1
sp|Q93063|EXT2_HUMAN	9.33e-28	264	490	456	684	Exostosin-2 OS=Homo sapiens OX=9606 GN=EXT2 PE=1 SV=1
sp|Q9WVL6|EXTL3_MOUSE	2.15e-27	262	490	660	886	Exostosin-like 3 OS=Mus musculus OX=10090 GN=Extl3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CDH55749.1.