CAZyme Information: CDH53963.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH53963.1
• CAZy Family: GH37
• CAZyme Description: alginate lyase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	CBTN010000020|CGC2	49632.87	7.0998

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000020:262680-264234(-)

Full Sequence      

MGPKKPEIEYIHLPALHDLKQRQRQNCQPQAYESLQKLAQGALKKGPFSVTFEKSEPHIA
ASGDKRDFLSYAPYFWPSDKDKDKYVRRDGKRNPDCALVKDQSQLEGFAENITYLCMGYY
LLGKEAYVNHAMKLIDTFLVNEETRMNPNVDYGQVIRGKDNPTGKGRGEGIMSTRALARV
ANVLPLIVTSPAVASIAPAVRTWFSEYLKWLLESDIGKEEAAKKNNHLTWYLVQVAMIQQ
FLGDELAARQTIENFFVNVFPKQVDEKGDQPHESSRTKPFHYLGFNLHAAIFLAELGLDI
GYDAYQDNQYLTNATKYMISTCQLHDPKEDPTGAVRTVEIVSSRCGGDQSYCEFIDTAKS
CKYSEHIDGPKHALCRLWCPEPVLEQNNQAPTAIQENQQPSSTQRNDNPISNNNDNQNRT
GSNKSVKGFFKQLFHHNN

Enzyme Prediction     

No EC number prediction in CDH53963.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	57	322	2.3e-87	0.9605734767025089

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.15e-61	49	319	1	265	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07499.1|PL38	3.98e-279	1	438	1	436
AFA26126.1|PL38	1.13e-127	1	380	1	382
AFA26122.1|PL38	1.60e-127	1	380	1	382
QDA61711.1|PL38	1.45e-52	39	332	65	362
ABD80546.1|PL38	2.99e-52	31	320	79	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.80e-38	31	319	29	318	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

CDH53963.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CDH53963.1.