CAZyme Information: CDH53088.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH53088.1
• CAZy Family: GH27
• CAZyme Description: glycosyltransferase family 49 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	CBTN010000016|CGC4	50059.99	7.8034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000016:74374-75844(+)

Full Sequence      

MRDKSLFVKVLKIAALAYISFSLLYATAHLLGIKKSTSSNGQLLPRSAKRVEPLTVSQLQ
ERYNGNQQVGWSSGSGTNSQKEFISEDLMLEKVFSDAMGPSKVIPYYLKAKESSFDNEEV
TISTLVTHNRFHVLSRLATRYKGPISVAIHVNDDDSKQVILTDLHRMYDANPDMGRYVDI
HLVVDRFDRQFNMWRNVAKFFARTDYIIMLDVDFHLCTDFRQSLKQHPILMDVLRSGTGA
VVVPAFEYINEEDGEDWRDFPKDKEALKEIVAADKIDMFHRSWVRGHGSTNYTRWYASDE
PYKVIDYNYSYEPYVIFKKEGTPWCEERFIGYGANKAACLYEIYLAGIDYWVLPHDFLIH
QTHHYPEETRAKERKYNKKLYDYFREEVCLRYSRTMIAAGLWDTPRADNVKRECSKIKGF
KEIVSRMYT

Enzyme Prediction     

No EC number prediction in CDH53088.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	106	393	1.8e-45	0.8545994065281899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	8.69e-56	120	392	2	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14203.1|GT49	2.80e-316	1	429	1	429
CDS06289.1|GT49	1.24e-245	1	428	1	425
CDS06217.1|GT49	1.17e-177	9	422	11	429
CDS09884.1|GT49	1.70e-176	33	425	4	391
CDS10115.1|GT49	6.23e-169	9	425	11	427

PDB Hits     

CDH53088.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Z1M7|LARG1_MOUSE	7.24e-26	112	363	466	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|O95461|LARG1_HUMAN	1.75e-25	112	363	466	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q6P7A1|LARG2_RAT	3.90e-25	119	363	401	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1
sp|Q66PG3|LARG1_CHICK	1.03e-24	112	363	466	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Gallus gallus OX=9031 GN=LARGE1 PE=2 SV=1
sp|Q66PG2|LARG1_DANRE	1.38e-24	112	363	467	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Danio rerio OX=7955 GN=large1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.974155	0.025857

TMHMM  Annotations     

Start	End
7	29