CAZyme Information: CDH52704.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH52704.1
• CAZy Family: GH20
• CAZyme Description: glycosyltransferase family 49 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		52106.31	6.1165

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000014:394194-395748(-)

Full Sequence      

MRLEVSQAFSRGTKYFLVFYTIVSLILTARHFYSYHASEGTDDDAAIFPRADENKAEMPL
LNSSSSLSHSKNSSQLQVDHQALAQSSDSSSHPADVAWPLDNGNSQSMDEDYVLSKIFSE
AMGPSNLTPYYRRASASVEKNDITMATLVTRNRFKVLSRLATHYKGPISAAIHVNDDDTK
QEVLDELHAVYESNPDMQSYVDIHLMLDNFDRQFNLWRNVAKFFARTDYIMMLDVDFHLC
TNFRQRIRNDPKIMALLDSGTAALVVPAFEFNLQDDGLDWRTFPTTKSDLLQEVESGKLD
MFHKSWLRGHGSTNYTKWYASEDLYKVTDYNFSYEPYIIYKKEGSPWCSERFIGYGANKA
ACLYEIYISGIDYWVLPDDFLIHQTHEYPEATRRKERQYNRKLYSNFREELCLRYARLFV
STGDWDSSKADNLRDQCHRIRGFRSAMNLA

Enzyme Prediction     

No EC number prediction in CDH52704.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	137	415	5.1e-47	0.827893175074184

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.15e-55	142	415	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09884.1|GT49	2.05e-269	58	450	1	393
CDS06217.1|GT49	8.34e-193	1	447	1	431
CDS10115.1|GT49	2.37e-186	1	447	1	426
CDS06289.1|GT49	3.62e-177	96	448	70	422
CDS14203.1|GT49	7.60e-175	96	448	69	425

PDB Hits     

CDH52704.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66PG2|LARG1_DANRE	3.86e-27	137	415	469	743	Xylosyl- and glucuronyltransferase LARGE1 OS=Danio rerio OX=7955 GN=large1 PE=2 SV=1
sp|Q5XPT3|LARG2_MOUSE	6.27e-27	139	386	399	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q6P7A1|LARG2_RAT	1.13e-26	141	386	400	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1
sp|Q66PG1|LARG2_DANRE	9.72e-26	135	386	460	702	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1
sp|O95461|LARG1_HUMAN	1.31e-25	137	415	468	742	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000038

TMHMM  Annotations     

There is no transmembrane helices in CDH52704.1.