CAZyme Information: CDH52126.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH52126.1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein RO3G_16093

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		46449.25	8.4652

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000012:176517-177734(+)

Full Sequence      

MALAPTTYSPPSMYLNALEKHHHHHHNIHHIHFSSLTQQAERRLQQQQQQQQPHLQRRVT
LLHQKPMAAAATQSSSSSSSTKKSEEHVVHKKKTKSVRFHEDKLEHVRLFLKTQRPLAVR
AGDPKRSMPALTAKFPNWPEKVVMTRQRDDTMVRMETVQLLDQDDDEMVILTGRCRVANI
AFHKRVVVRYTTDYWQSYHETEAIYREPIGASANTWDRFTFRINLEQQQQPCTVYMVLRY
TVHDNEFWDNNEGLNYQVDLELAEEDDDDVDEETLSTTTKVASNKEGVLQKHENGLSNTN
NIKHHENPRQKKIVKKKLGHRYDFGASLSAAKKMEPVVKPSFANMTTTTTITTTPTPFVM
MTATLENDDQAKYHDLVSKYCFYGNPRAATSGAAASATTAEPICG

Enzyme Prediction     

No EC number prediction in CDH52126.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	153	258	3.2e-27	0.9532710280373832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	1.63e-33	147	258	1	112	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	3.07e-08	179	258	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05148.1|CBM21	9.42e-187	1	405	1	394
CDS02860.1|CBM21	2.06e-55	90	405	60	374
QQK40731.1|CBM21	8.03e-26	94	393	257	591
CAP80870.1|CBM21	1.89e-21	94	386	257	625
QLI72402.1|CBM21	2.55e-21	94	261	172	355

PDB Hits     

CDH52126.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O95685|PPR3D_HUMAN	5.60e-10	106	258	130	277	Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
sp|Q7TMB3|PPR3C_MOUSE	2.05e-09	171	258	169	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q8BRJ4|PPR3E_MOUSE	2.07e-09	161	256	164	256	Protein phosphatase 1 regulatory subunit 3E OS=Mus musculus OX=10090 GN=Ppp1r3e PE=1 SV=2
sp|P0C7L8|PPR3E_RAT	3.73e-09	161	256	164	256	Protein phosphatase 1 regulatory subunit 3E OS=Rattus norvegicus OX=10116 GN=Ppp1r3e PE=2 SV=1
sp|Q0VCR4|PPR3C_BOVIN	8.85e-09	171	258	169	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CDH52126.1.