CAZyme Information: CDH51655.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH51655.1
• CAZy Family: GH152
• CAZyme Description: hypothetical protein RO3G_14659

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	CBTN010000010|CGC6	43875.10	7.0954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000010:482442-483932(-)

Full Sequence      

MVIHLFYLLILLFLSKATSAAAETGKVIVGYWGVWDSKPLPIKYIPWSQITHINFGFATV
NKDVVPALKNQGALSNLVKEAHENNVKVLLSIGGWRTRLPCNQSIITNTTTEDHLLPLLE
QFREALGDDKLLTLGVGATPYPYSNVSGYQQVVDWITIMAHDTHVGRPTIGANSPLYNND
ASSNSALEAWNAWMSIPSQQRVLGVPFYGYASKPIRNKKDGDLEKLTGPAHSMRPPGDAD
DPMLPDTCKRGYSGLWRWRSLRNTGILLDESRAGKHWIKHWDTSSQTPWLYNSLSNVVIS
YDDPQSVRLKTTFAMCQQARGIGVWDLAYDYYTSGNGQLLTAIHDALNTTHPKCDLTLIH
PDADPVDSIGTYILPQSIFFAFLYVIPMVLFQL

Enzyme Prediction     

No EC number prediction in CDH51655.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	26	334	1.8e-42	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	2.38e-41	27	330	1	334	Glyco_18 domain.
395573	Glyco_hydro_18	2.85e-38	27	330	1	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	2.43e-34	28	330	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	1.28e-31	27	347	39	436	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	2.48e-19	28	347	1	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS04937.1|GH18	7.39e-237	1	391	3146	3576
CDS06898.1|GH18	5.05e-47	10	356	13	421
AMP42675.1|GH18	4.47e-42	15	344	24	415
CDS13735.1|GH18	8.53e-40	4	340	7	402
AJD76187.1|GH18	1.58e-39	26	344	2	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	1.24e-33	25	351	1	373	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6BT9_A	6.44e-18	118	334	230	452	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
5GZU_A	1.01e-13	25	347	512	881	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.10e-13	25	347	763	1132	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
3WD0_A	2.25e-13	20	348	3	427	Serratia marcescens Chitinase B, tetragonal form [Serratia marcescens],3WD1_A Serratia marcescens Chitinase B complexed with syn-triazole inhibitor [Serratia marcescens],3WD2_A Serratia marcescens Chitinase B complexed with azide inhibitor [Serratia marcescens],3WD3_A Serratia marcescens Chitinase B complexed with azide inhibitor [Serratia marcescens],3WD4_A Serratia marcescens Chitinase B complexed with azide inhibitor and quinoline compound [Serratia marcescens],4Z2G_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 26 [Serratia marcescens],4Z2H_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 29 [Serratia marcescens],4Z2I_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 30 [Serratia marcescens],4Z2J_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 31 [Serratia marcescens],4Z2K_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 32 [Serratia marcescens],4Z2L_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 33 [Serratia marcescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11797|CHIB_SERMA	1.53e-12	23	348	2	423	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1
sp|P20533|CHIA1_NIACI	3.46e-12	14	330	33	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|A5FB63|CHIA_FLAJ1	7.93e-12	4	352	3	468	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
sp|P96156|CHID_VIBFU	9.28e-11	22	355	316	799	Chitodextrinase OS=Vibrio furnissii OX=29494 GN=endo I PE=1 SV=1
sp|P36222|CH3L1_HUMAN	2.62e-08	21	350	5	383	Chitinase-3-like protein 1 OS=Homo sapiens OX=9606 GN=CHI3L1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999725	CS pos: 20-21. Pr: 0.7888

TMHMM  Annotations     

Start	End
369	391