CAZyme Information: CDH51508.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH51508.1
• CAZy Family: GH152
• CAZyme Description: oxidoreductase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	CBTN010000010|CGC3	39350.71	6.7237

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000010:179867-181084(+)

Full Sequence      

MAKVNVGVVGFGFSSRTFHCPLIVSSPHLQLTAVVERHNNKSKEVYPWVTVAKSTDELFA
MDNVDMVVITTPNDSHFSLAKEAMEKGKHVVVEKPFTVTSEEASELVKISEKTNKICSVY
QNRRWDGDFLTVKKLLAGGQLGRLVEFESHFDRFRNFVKPGWREKDDQPGSGMLYDLGAH
LIDQALSVFGLPKSIYATISNQRQLAESNVVDDFTIILKYADGFSALLRSSMLARQSPVL
RFSLRGMNGSFVKHYLDVQEDQLKAGLLPSSAGYGVESQDRWGIINSDINGLHITGNVET
LQGDYLSFYNNVGEAILKNDRNHLAVKPEHGVNCIRLIELAQKSSDEGRAIEL

Enzyme Prediction     

No EC number prediction in CDH51508.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	152	3.6e-24	0.40350877192982454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
183212	PRK11579	1.21e-111	3	353	4	345	putative oxidoreductase; Provisional
223745	MviM	2.16e-68	1	353	1	340	Predicted dehydrogenase [General function prediction only].
182305	PRK10206	5.62e-58	4	310	2	302	putative oxidoreductase; Provisional
396129	GFO_IDH_MocA	2.17e-31	4	120	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
397161	GFO_IDH_MocA_C	4.76e-24	133	353	1	204	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
URX63132.1|GH0	2.47e-12	1	231	1	236
UPG91011.1|GH0	3.33e-12	1	231	1	236
QSE48187.1|GH109	5.56e-12	1	175	52	234
QYX71592.1|GH109	5.56e-12	1	175	52	234
AVV86094.1|GH109	5.56e-12	1	175	52	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHL_A	1.06e-87	4	353	6	353	Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_B Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_C Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_D Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343]
3KUX_A	7.29e-77	3	353	7	348	Structure of the YPO2259 putative oxidoreductase from Yersinia pestis [Yersinia pestis]
3E82_A	1.62e-72	4	348	8	340	Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3GDO_A	2.15e-71	4	353	6	348	Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GDO_B Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
3GFG_A	2.78e-71	4	353	15	357	Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_B Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_C Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_D Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_E Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_F Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_G Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_H Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_I Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_J Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_K Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_L Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42896|YBQ3_SCHPO	7.56e-80	1	353	1	368	Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC115.03 PE=3 SV=1
sp|P77376|YDGJ_ECOLI	4.96e-78	3	345	4	337	Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) OX=83333 GN=ydgJ PE=1 SV=2
sp|O13991|YEG9_SCHPO	3.10e-76	1	353	1	367	Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.09c PE=2 SV=3
sp|O32223|IOLW_BACSU	1.10e-70	4	353	14	356	scyllo-inositol 2-dehydrogenase (NADP(+)) IolW OS=Bacillus subtilis (strain 168) OX=224308 GN=iolW PE=1 SV=1
sp|P46853|YHHX_ECOLI	1.01e-49	4	324	3	317	Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) OX=83333 GN=yhhX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CDH51508.1.