CAZyme Information: CDH50649.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH50649.1
• CAZy Family: GH105
• CAZyme Description: chitinase domain-containing protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	CBTN010000007|CGC3	41682.06	4.6347

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000007:555819-557481(-)

Full Sequence      

MTILLLLLPLLLSFATVHCHCPDFHHETQFTLATLENANTAESILRLHDQVKEPHVKKFG
GDTLAYVTPWNNRGYDVVKEFKGKFDYVSPVWYYVERTNEPGDEIFKIIGEHDVDAKWMA
EVRGPNTGKIVPRFQFRNWDFNGYQSFASNPEDAHKMVELLMGQVRKHGFDGIVVECGYP
TFFPLFINNMAAALHNDNKEFIVVLPPLRSAEQSKILNRDIFASLAQVVDRFSIMTYDYS
SHAPHGGPSAPVDWIMDNIEQLTNDENAHQLLVGINLYAMSYQETRMPEAKILSSVLETL
DGKELEWDEESEEHWFEDDDGSKVWMPTRKSIEKRVHLAEDYEVGLSLWEVGQGLDYFYE
LL

Enzyme Prediction     

No EC number prediction in CDH50649.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	136	353	1.5e-25	0.7094594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119355	GH18_SI-CLP	3.42e-90	59	362	1	318	Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome. SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.
119353	GH18_CFLE_spore_hydrolase	7.48e-21	63	353	4	304	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
119349	GH18_chitinase-like	2.35e-13	65	238	3	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
226376	YaaH	4.19e-13	54	353	95	409	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
214753	Glyco_18	1.24e-11	64	283	3	241	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11651.1|GH0	2.12e-225	41	362	6	326
AAX08647.1|GH0	1.55e-62	55	362	73	393
AEE62088.1|GH0	3.66e-59	59	362	88	403
AAH13642.1|GH0	4.26e-59	57	362	1	319
KAE8748253.1|GH0	1.15e-58	56	362	55	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BXW_A	7.59e-60	57	362	75	393	Crystal Structure of Stabilin-1 Interacting Chitinase-Like Protein, SI-CLP [Homo sapiens],3BXW_B Crystal Structure of Stabilin-1 Interacting Chitinase-Like Protein, SI-CLP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5EAB4|CHID1_BOVIN	2.75e-63	55	362	73	393	Chitinase domain-containing protein 1 OS=Bos taurus OX=9913 GN=CHID1 PE=2 SV=1
sp|A0JPQ9|CHID1_RAT	9.98e-60	27	362	37	393	Chitinase domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Chid1 PE=2 SV=2
sp|Q5RFF6|CHID1_PONAB	3.90e-59	57	362	75	393	Chitinase domain-containing protein 1 OS=Pongo abelii OX=9601 GN=CHID1 PE=2 SV=1
sp|Q9BWS9|CHID1_HUMAN	3.90e-59	57	362	75	393	Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1 PE=1 SV=1
sp|Q922Q9|CHID1_MOUSE	7.72e-59	27	362	37	393	Chitinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Chid1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000183	0.999767	CS pos: 19-20. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in CDH50649.1.