CAZyme Information: CDH50415.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH50415.1
• CAZy Family: CE4
• CAZyme Description: glycoside hydrolase family 31

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	CBTN010000006|CGC1	91920.84	5.5720

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000006:577147-580088(-)

Full Sequence      

MQPHEQAQWRELSHCVEMDNKELAVLADTLFPSFLFILFMLQSFIKSVGLAPLDAYVEPR
ISIGNAVYDRESSTGNFKVHMDAQARALIIKNSKGRVIWKSLHNIPFLLSSIGDDEITTE
PYNDALYKIVEHDEHITRLQTITRIETSNNQVRIYGGLGTKISPATHLDYEFILEELSPN
QLHFTARIVNRDTPMANYQRLLLVFESHKDEDFYGFGEQYTYGSLKGHKVPIMIRERGHG
RGGPQASSFINSAVSFVEGYFGGDDGYCSSTLSVPQYITSDRRCLFLETSEYTSFNLTDP
DRVTVRIDASEMAGRIVDGESMLELITEYTSYCGRMAPLPDWVNEGVVAGISGGKDKVYQ
IVEQLQHHDTPLAAVWIPDWCGQRVQSLTPNVALKRLWWNWEADTNAYPDWNGFVKELTN
DKNVRVLSYINPLLTTTQKPGTQRDLYQEAANKQYLVRAPNQQPYIVHSGGLEAGLLDLT
NPEAREWFKSVLIDQVWDAGISGMMVDSGEELPYDARKIILKENKPPSTYHNLYAEMWAK
LNQEVMEEQSLHDAVCFYRAGYTRSPQYMSLAWTGDHNVCWDQTDGLKGAVAAMLSGGFS
GFTLTHSDIGGYNTIEGQLRGASMTRSRELLYRWMELAVFTAMYRTHEGILPERNAQFYD
NDETYTHFAHMAKLYVALAPYRKKLMQEAHEKGWPMMRHLVLYYPHDATVRQLCYTQFLF
GPDLLVAPTLSPSASFVKVYFPQDSRDVSWRHVWSGKYFEADGSYKTVDTPLGQPAMFIK
EPRQDNGLLNNLVDFANTYCDYVANVK

Enzyme Prediction     

No EC number prediction in CDH50415.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	317	781	6.1e-87	0.9812646370023419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	0.0	196	781	67	619	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	1.87e-162	334	672	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	1.58e-85	205	799	147	693	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	5.45e-61	319	781	5	438	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	5.50e-48	400	742	49	360	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13477.1|GH31	0.0	40	807	1	769
QIN82013.1|GH31	5.56e-164	153	781	125	722
ABG05503.1|GH31	2.55e-161	60	781	41	718
CAP79722.1|GH31	5.14e-160	77	788	29	741
BCS07610.1|GH31	3.85e-159	71	779	36	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNR_A	9.02e-109	209	781	110	650	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5AED_A	4.32e-102	197	780	113	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	2.31e-101	197	780	113	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5OHY_A	2.17e-93	200	792	99	660	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	1.14e-92	200	792	99	660	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	1.82e-101	197	780	113	663	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|Q9F234|AGL2_BACTQ	4.97e-29	198	781	133	670	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|P31434|XYLS_ECOLI	1.20e-25	211	764	160	647	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|O04931|AGLU_BETVU	1.00e-15	301	743	279	720	Alpha-glucosidase OS=Beta vulgaris OX=161934 PE=1 SV=1
sp|Q653V7|AGLU_ORYSJ	2.23e-15	319	742	271	691	Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0675700 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000011

TMHMM  Annotations     

Start	End
23	45