CAZyme Information: CDH49248.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH49248.1
• CAZy Family: CBM50|CBM50
• CAZyme Description: glycosyl transferase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		36419.05	7.8290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000003:186392-187430(-)

Full Sequence      

MRMESSVSALFSRFFSSIHTTIRETAMVSKTVPKAAWVVVLTSTNNYIKGAIALAQALRM
TQSLYPLVVLYTSAVTKRAIQLLKDAGCHVRPINPIHPPGKTRYVFERFVETWTKLAVWN
LEEYERVVLLDADMLPLQNMDELMMDIALPDEHHIAACHACTCNPQKIKTYPADWYVLIY
AAREMIGPIGLIVLKPSRSKFQEIISHLYRIPDLTSYRFPDQDFLNEVFEHRWIHLPYIY
NALKTLSVAHRTMWKFQEVKNIHYILSNKPWDDYADDERYSAQYRLWQDVYTEAINYAKL
STSDIQSALSTTTT

Enzyme Prediction     

No EC number prediction in CDH49248.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	22	273	7.9e-46	0.933852140077821

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	4.16e-73	36	294	2	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	4.19e-35	22	297	10	298	galactinol synthase
133037	GT8_A4GalT_like	2.09e-14	39	273	3	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
279798	Glyco_transf_8	1.51e-13	38	275	1	252	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133064	GT8_GNT1	2.78e-12	46	229	11	170	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07185.1|GT8	3.70e-175	27	312	1	290
CDS07125.1|GT8	2.44e-105	33	280	7	259
ABW74133.1|GT8	3.97e-79	35	259	1	241
QKV90060.1|GT8	9.90e-67	36	289	3	271
QWA13296.1|GT8	1.02e-66	36	293	3	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	1.56e-14	34	294	7	259	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
4UEG_A	5.51e-11	39	272	7	221	Crystal structure of human glycogenin-2 catalytic domain [Homo sapiens],4UEG_B Crystal structure of human glycogenin-2 catalytic domain [Homo sapiens]
3USQ_A	6.16e-10	39	295	27	277	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1ZCV_A	6.27e-10	39	295	27	277	Chain A, Glycogenin-1 [Oryctolagus cuniculus]
1ZCT_A	8.25e-10	39	295	27	277	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XGN4|GOLS1_AJURE	5.16e-31	23	293	11	293	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|O22693|GOLS4_ARATH	1.97e-30	33	293	21	294	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|Q4PSY4|GOLS7_ARATH	3.70e-28	29	309	13	308	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|Q9FXB2|GOLS2_ARATH	1.04e-27	34	304	21	305	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1
sp|O80518|GOLS3_ARATH	2.74e-27	34	297	15	292	Galactinol synthase 3 OS=Arabidopsis thaliana OX=3702 GN=GOLS3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999943	0.000075

TMHMM  Annotations     

There is no transmembrane helices in CDH49248.1.