CAZyme Information: CDH49183.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH49183.1
• CAZy Family: CBM50
• CAZyme Description: glycoside hydrolase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		38451.51	4.6822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000003:7999-9277(-)

Full Sequence      

MRSAVAAAFSLATTVGILSSSLVAASSDPVVCDCGFQDENGRIWSEIWHSDYNTYKANLQ
KDKSYIVMNYTVPPKHDDTLERLFDPANVQLASQDGESSFSGLQLAVRKQDNGQFTSASF
GTKREDFMYGTFRASMKTTSVPGTVQAFFFFRDNTCEIDIESVSRIQNPWQSYFSVQPQI
YNEDGSASNLTNIKDPIDFDPTADFHEYRFDWTPDAVTYYLDGTEATRLTHNVPRYPGRV
LVNHWTDGNPKFSGLPDQDAFLHVANMTVFFNSSEATAPPACQQRQTPCSVADIMSQKLL
PASSNSGTSSPPGNNNHESAAAAAFTRYSSVLLYTTVLYTLSFFITA

Enzyme Prediction     

No EC number prediction in CDH49183.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	90	267	6.1e-61	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.31e-38	84	264	27	204	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	2.83e-19	102	259	40	198	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	1.55e-15	102	250	12	137	Glycosyl hydrolases family 16.
185692	GH16_fungal_CRH1_transglycosylase	3.06e-13	102	251	25	170	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185693	GH16_laminarinase_like	1.23e-09	111	225	60	180	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07094.1|GH16_23	1.99e-196	1	347	1	344
CDS07155.1|GH16_23	7.94e-63	32	305	41	323
CAE7022543.1|GH16_23	5.09e-36	13	304	5	323
QRD00920.1|GH16_23	1.02e-34	92	276	110	303
CEI68761.1|GH16_23	2.06e-33	32	286	19	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WVJ_A	7.17e-14	112	245	63	186	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
1MAC_A	4.11e-11	93	245	40	182	Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	4.24e-11	93	245	42	184	MOLECULAR AND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]
1U0A_A	1.95e-10	93	245	42	184	Chain A, Beta-glucanase [Paenibacillus macerans],1U0A_B Chain B, Beta-glucanase [Paenibacillus macerans],1U0A_C Chain C, Beta-glucanase [Paenibacillus macerans],1U0A_D Chain D, Beta-glucanase [Paenibacillus macerans]
1CPN_A	2.43e-10	129	245	14	126	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q84C00|GUB_ACETH	2.21e-13	112	245	92	215	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1
sp|A3DBX3|GUB_ACET2	1.34e-12	112	245	92	215	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1
sp|P45797|GUB_PAEPO	1.67e-12	93	245	66	208	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1
sp|Q53317|XYND_RUMFL	7.49e-12	109	245	633	759	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2
sp|O14412|GUB_ORPSP	1.57e-11	103	245	77	213	Beta-glucanase OS=Orpinomyces sp. (strain PC-2) OX=50059 GN=licA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999682	CS pos: 25-26. Pr: 0.8782

TMHMM  Annotations     

There is no transmembrane helices in CDH49183.1.