CAZyme Information: CDH48867.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH48867.1
• CAZy Family: CBM21
• CAZyme Description: glycoside hydrolase family 37 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		67275.74	4.8271

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000002:337664-339749(-)

Full Sequence      

MRLLCRSLLLAAIAVVTTATKQGQHNTNKTFPRCDSPIYCEGPLLKTVQLAKLYPDSKTF
VDKPTSKPLNQVIEAFEAMGDNPSADSIRNFVDANFLEEGTELQPVNLSVRADLPLLDKI
DDLTYRGWASQIHQYWSNLTFKFDLNQLCDGCVSSILPVKRPFVVPGGRFREFYYWDSYF
VIRGLLVSELHNEAKDMLLNFLDFVEEYGFIPNGARIYYLNRSQPPFLVEMIKAYYEATH
DDDFIKQALPTLDKEYSFWMANKSIDVNGHTLNQYRVLNSSPRPESYLEDYTTAQNVTDK
ARLYGNLATGAESGWDYTSRWFRYKDSQDGDYLLQSLNNDNIVPVDLNALMWNMESTLSE
WHTSSRKKKYYKRQAAKRIEAMKEVLWDEEDVSFYDYNITSSGLNREFTPATLYPFWLGA
HHRLSKEQMGQVLAQTQHWLEAYPGILTTSVYNTSQQWDFPNGWPPLQYIALRAMRNVYD
ATKDSSIVDMIHALADRYLASAFCSWYETGGFVPGILQQMPNQTDVGHMFEKFEVTVIGD
AGGGGEYIVQAGFGWTNGVALWIFDTFSSGFSAPDCSDRADLVFPLSSS

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	54	565	7.9e-155	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.22e-162	52	561	1	502	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.38e-135	39	567	13	544	alpha,alpha-trehalase
237326	treA	3.16e-109	2	565	10	534	alpha,alpha-trehalase TreA.
224541	TreA	2.25e-102	3	570	18	555	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	1.52e-99	3	570	11	539	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07813.1|GH37	0.0	1	587	1	586
CDS03696.1|GH37	3.90e-222	34	588	30	604
SMR59387.1|GH37	8.73e-144	34	579	27	635
ADX41482.1|GH37	2.98e-143	4	578	3	640
SMQ54948.1|GH37	6.93e-143	34	576	27	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z66_A	3.13e-92	36	565	46	537	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	5.55e-88	42	565	15	500	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	4.49e-81	42	565	15	500	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	1.12e-80	52	561	36	548	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.66e-79	52	561	36	548	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	1.86e-134	34	576	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	1.43e-116	26	575	34	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|P19813|TREA_RABIT	7.98e-116	32	573	26	555	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	2.11e-115	32	567	23	547	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	1.02e-114	32	567	26	550	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000399	0.999570	CS pos: 19-20. Pr: 0.9395

TMHMM  Annotations     

There is no transmembrane helices in CDH48867.1.