CAZyme Information: CDH48809.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH48809.1
• CAZy Family: AA7
• CAZyme Description: glycosyl hydrolase family

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146		16396.10	5.6650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000002:194406-194908(+)

Full Sequence      

MDGHLNKEVIIMLMPIGPSDPLRIHLIDTLHAQVTALAKYQDPSGLWRTIIDEESYLEAS
ATAGFAFGILKAVRKRYISKEYKDIALNAIKGVIDNINDQGELEKVSFGTPVGDTRQFYK
EIPLTSMPYGQAMGMMCLVEFLRLYI

Enzyme Prediction     

No EC number prediction in CDH48809.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	12	143	3.5e-40	0.4036144578313253

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.81e-37	10	145	216	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.50e-33	20	145	212	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07763.1|GH105	2.75e-81	11	146	237	372
QSF55858.1|GH105	4.33e-54	11	146	232	368
QKX63029.1|GH105	9.86e-53	10	146	230	369
AYV47304.1|GH105	1.10e-51	11	146	232	369
AVQ02878.1|GH105	8.64e-51	11	146	232	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	1.54e-44	13	145	248	381	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	8.27e-44	13	145	247	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.90e-39	8	146	229	373	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	6.23e-08	13	124	278	392	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	9.36e-07	26	95	226	300	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.26e-13	29	143	227	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000032

TMHMM  Annotations     

There is no transmembrane helices in CDH48809.1.