CAZyme Information: CDH48651.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH48651.1
• CAZy Family: AA6
• CAZyme Description: alpha-arabinofuranosidase ii

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	CBTN010000001|CGC1	63468.18	5.3954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000001:1137607-1139391(+)

Full Sequence      

MLLLTHVLLLSLFFFSLAVVIAAIGDTDTLIPFDDASIKYYGRWHRTIKEIQSGWPGAYF
KTTVEGGSRIKLRLNRPTSVFVQVDYGSVRQLQAEYQGQLPIELDITPPLNQEDDDDEKD
YELLVAASANASIYLESLVISSQGRSNKTHPPDKQSPLLVEFVGHELSLGVGTSQSLFTS
FPWLVSSMVSAEHAQIAYNRARLENYTSRDLGMETRYFDWSPHDSEAWWNFSYAPTAIVI
LLGRNDRISDDYADTLVNFLKRIRSHLPDTSILILSEPLGDLVRQSQDAVYHLNDQGDQN
IFYIDTTGWVQYGATAFVDTTHLNDAGHDRVARRLAPLLEARLATPPRPLPPPPSNPSLP
HDWQTMDIGQDERVGLPGSVSFDSPHTFTLWGSGVDIGGHQDAFRFVYQSLSGNGVIEAT
VESHSAFSSCAKAGIMIREHLALGAPHVLFGVSPASGIFFQARSSNFNETRLVKKLRASP
PYRFRLVRHDSSWIAQSSSSPSNSDDSQAEWQLVANITDLVFARDVYVGLAVTSCDPSVV
SVAKFAEISLSGGVGNGFYSSDLHIPRLIHQQP

Enzyme Prediction     

No EC number prediction in CDH48651.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	175	337	5.2e-21	0.8516746411483254

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	3.77e-13	160	340	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238881	SGNH_hydrolase_like_6	4.27e-07	252	339	76	177	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.77e-06	233	330	60	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.24e-06	215	338	46	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	3.29e-04	235	340	49	169	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UAB92674.1|CBM2|CE2	1.32e-34	22	347	26	341
SCG80541.1|CBM2|CE2	2.31e-34	22	351	33	352
ATB41364.1|CBM42|CBM66|CE0	8.03e-34	8	339	20	345
QFY13390.1|CBM2	1.75e-32	20	349	31	350
QDY10106.1|CBM2|CE2	2.32e-32	22	351	54	373

PDB Hits     

CDH48651.1 has no PDB hit.

Swiss-Prot Hits     

CDH48651.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000364	0.999602	CS pos: 22-23. Pr: 0.9701

TMHMM  Annotations     

Start	End
2	24