CAZyme Information: CDH48511.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH48511.1
• CAZy Family: AA2
• CAZyme Description: acidic mammalian chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		43521.22	8.5522

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000001:730697-732384(+)

Full Sequence      

MITLPGRLFLLFQALVLVLAATTCNAAKHKDGGVIAYVVDWDLPSKIAWNKLDQVIYSFA
EPEKNGKLSGFDESQLKSVVKEGHKHDTLVSLAVGGWTGSLYFSDLAKTEKSRQKFAKNI
AKLVKKYDLDGVNLDWEYPNSPNGVACNANDPHDTANYLKLIQTLREVLPKHTLITAAVG
TTPFNDENQQPSTHLDKNWAKAIDGIYIMGYDINGIWNTQAGANAPLRANAKAAGIDTAS
VDSAVKAWTAAGIPSEKLVLGVPFYGRIGQTTGKAHGLYGKLDTSEGQIRGDQYDSKEKD
PCPNAKASYSGQYEWRSIAKEGIARNESGWNTVWDSISQTPVAVKGSKFITFDDAHSLHA
KAQYAKKQKLSGVMLWSLEMDDAHNTLLNALQGVRSKH

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	34	386	1.4e-69	0.9459459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	4.82e-77	34	381	2	334	Glyco_18 domain.
119365	GH18_chitinase	1.45e-70	34	381	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	4.77e-69	34	381	2	307	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	2.03e-64	55	391	31	358	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	6.94e-53	1	391	1	432	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03542.1|GH18	2.77e-264	1	397	1	387
AYA60264.1|GH18	3.07e-58	11	392	4	399
QBZ63682.1|GH18	4.53e-57	26	393	50	429
AMP42675.1|GH18	7.19e-57	12	396	6	419
ATY63066.1|GH18	2.63e-56	19	393	10	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	2.73e-162	36	395	6	369	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	2.25e-40	74	393	111	417	Chain A, Glycosyl Hydrolase [Niallia circulans]
6KST_A	3.35e-40	34	391	9	366	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	1.75e-39	34	391	9	366	Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6JM7_A	1.38e-38	61	384	53	353	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	2.95e-38	74	393	143	449	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q9W092|CHIT2_DROME	4.26e-36	20	382	29	390	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
sp|P36362|CHIT_MANSE	2.52e-35	25	382	31	376	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q6RY07|CHIA_RAT	6.90e-31	55	382	54	366	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q9BZP6|CHIA_HUMAN	7.13e-31	47	389	69	373	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999779	CS pos: 26-27. Pr: 0.9734

TMHMM  Annotations     

There is no transmembrane helices in CDH48511.1.