CAZyme Information: CDH48380.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH48380.1
• CAZy Family: AA1
• CAZyme Description: glycoside hydrolase family 37 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	CBTN010000001|CGC6	69126.61	4.6911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000001:403775-405959(-)

Full Sequence      

MRFAAFQSCLLYMAASTTTLTLAIDAIYTCDSPIYCDGPLLRAVQLARLFKDSKTFVDMP
TVKPVDQVLAAFEDIGGENASRDDIAMFVSENFAPAGTEVTRYPLPAYDDPGWFDQVDDL
HYRGWLEVLHRTWGNLTFQYDASQICDGCGSTLLPSKHPFVLPGGRFREFYYWDSYFTIR
GLLLSDLDELAREFIQNILDFVDTYGFMPNGARMYYLNRSHPPFLTEMVKEYYAKTHDDE
FLKQALPVLDKEYTFWKTNTSVQLTDPSTGNHYKLNRYIVDNDAPRPESYSEDYDTAYLD
TDYNDEQLYELFSNLAAGAESGWDYSSRWTKIKQSHDPHGYDILRTLNVHNIIPVDLNSL
LYSMESTLATWHRDGSGKQKYYKRQAARRLEAMDRFLWDEDAASFFDYNLTSQSRSHEFT
PASLFPFWMGAVPNRVKNNQETLQHVLDMTRKAMQQDPGVLTTSEYNTHLQWDWPNGWPP
LQFAAVKAMMTIGTMLKDIDQKQKTHTLARTLAERNAASGYCSWYRTGGSLPNGLLAKLP
DEKDNGHMFEKYDVRTMGEAGFGGEYVVQVGFGMTNGVLMWMLDTFPDLEAPDCNAVFAY
PIQ

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	49	585	2.8e-149	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.19e-144	48	587	1	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	3.96e-133	35	586	13	544	alpha,alpha-trehalase
237326	treA	2.44e-95	2	597	7	546	alpha,alpha-trehalase TreA.
224541	TreA	6.57e-95	32	592	53	558	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	2.01e-94	8	587	15	537	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03696.1|GH37	0.0	1	603	1	603
CDS07813.1|GH37	7.70e-229	30	603	33	586
SMR59387.1|GH37	1.73e-150	25	586	22	623
SMQ54948.1|GH37	4.88e-150	25	586	22	623
SMR63222.1|GH37	3.09e-148	25	586	22	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JG0_A	5.33e-84	38	601	15	517	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	2.26e-82	32	597	46	549	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	3.44e-80	38	601	15	517	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	8.59e-80	52	586	40	554	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.26e-78	52	586	40	554	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	7.93e-128	30	586	49	585	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|P19813|TREA_RABIT	1.35e-114	30	588	28	551	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	1.40e-113	30	588	25	549	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	2.28e-110	30	601	28	565	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|A8J4S9|TREA_APIME	7.50e-102	30	593	41	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.863161	0.136852

TMHMM  Annotations     

There is no transmembrane helices in CDH48380.1.