CAZyme Information: CCG84703.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG84703.1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		70076.69	7.1078

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965224:11424-13289(-)

Full Sequence      

MWENRRQSQIWQLTIGDDLKPGYIRRGSNAIRNASVTSLKGFNTWTGAPPRRVSDIIEFI
ATVKTQKEKDAKTRPWLRRSRIFPPVYVLSILLFIYFLFVGRPVWNGLAFEFWSYFNKRS
NFAIGTIVWMSWAGLQAFLPIIFCRFEQEVDPVENRDASETALIIPAYKAAGLLGATIEH
ALKIFTKSQIFIIANGNSKEPLDNAAEVCAKYGVNHYWVPIGSKITAEFVGVAVASKYKY
VMLIDDDVHLPANLPIVSDRINEQTKCIGYTIKSTGADGIKGTYVQQCQDMEYKSSGLTR
DWSGRWGSANFPHGAIILWEREALQSLFTSHPGYIISEDWYFGHCARQAGFRIEFCSQVF
VETETPPCLLWDNAGGRGGYGEMTVWKQRFYRWNYFYLFRIYDDLLYLFFNWRLGFREVT
AKYAVLIEIVDSVMNLFRPFIFVISLVLNWRLSLIYMAAIMGLYLLAFVVFNEWQLRLKN
ERVSLKIIPLYFFMKFVLLWFGTASMYYGIYSYIKYFSQRHPKVIENHEALEAAYNIRCG
VDLVPLADTVSEVIEQVEEVQQTRSDEADIVELTEVSPESSVGDLEKGGDMAPDEKVAPG
GMFSGFSMRQ

Enzyme Prediction     

No EC number prediction in CCG84703.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	161	367	1.4e-19	0.9173913043478261

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	1.38e-21	161	395	4	229	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
224136	BcsA	5.39e-15	122	514	16	404	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	2.33e-10	240	454	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
404400	Glyco_transf_21	5.70e-05	231	393	25	172	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.
133045	CESA_like	6.73e-05	163	327	1	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD00921.1|GT2	5.12e-176	55	534	129	616
CAE7014388.1|GT2	8.32e-137	46	541	241	744
QKX60961.1|GT2	3.06e-134	46	537	151	660
CAK44102.1|GT2	8.16e-133	46	537	157	658
UPL00273.1|GT2	2.26e-131	52	538	169	657

PDB Hits     

CCG84703.1 has no PDB hit.

Swiss-Prot Hits     

CCG84703.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

Start	End
82	104
124	146
393	415
425	447
452	474
489	511