CAZyme Information: CCG84692.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG84692.1
• CAZy Family: GT39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		45008.19	6.6142

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965223:6809-7990(+)

Full Sequence      

MRAAGSNRSLLIVCCGLAAALYYFWNSLHGLKQLADPEVVEDEHELDVSSALIDVPLPQV
SFPKYAEYPAHNSKNPKGYAYATLLCTHDPNERDPFFIAAQQIVWRILWSDWHSQYPIIV
FVCPSTPSYQRRILAGQGAIIEEIELITVSDPSKLHLSRWRDQLTKLNMWKYTDYKRITF
LDVDAFPVQNMDDIFDVVPTQECIRSKLNAEDKKVMEDPAAGRELCGYTFGGTVMSENDG
AYLNGGVFVFAPSRVWHAKLMRDLEKTDQYDVQTAEQGLLDSVLGFSKRGPFPRHDFSQN
YNADGQFYLDHNERGTIKVIHCKMWSPLSLTHAPELNIRWDVDWMSMARFYDSDIFALAR
QTGHRKEPLEVLGEMAEKAEAKKRRKKKGGHHK

Enzyme Prediction     

No EC number prediction in CCG84692.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	98	322	8.5e-20	0.7782101167315175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.21e-28	79	340	1	233	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	4.37e-10	141	327	134	338	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	6.97e-10	114	267	51	208	galactinol synthase
132996	Glyco_transf_8	1.03e-06	144	321	59	236	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133064	GT8_GNT1	0.002	160	195	77	112	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI69366.1|GT8	2.96e-89	56	363	56	369
QLI72824.1|GT8	1.00e-87	56	372	55	378
SMR50089.1|GT8	2.62e-55	36	361	137	447
SMR48904.1|GT8	2.62e-55	36	361	137	447
CBX95847.1|GT8	1.58e-54	37	360	97	431

PDB Hits     

CCG84692.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43061|MU136_SCHPO	7.10e-14	80	352	58	364	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q4PSY4|GOLS7_ARATH	1.03e-12	114	321	48	255	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|Q947G8|GOLS1_SOLLC	2.39e-11	114	281	48	207	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|O22693|GOLS4_ARATH	2.08e-10	114	267	51	209	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|O22893|GOLS1_ARATH	2.20e-10	114	321	58	265	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000038

TMHMM  Annotations     

Start	End
7	25