CAZyme Information: CCG84409.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG84409.1
• CAZy Family: GT22
• CAZyme Description: Glyco_hydro_114 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
142		15387.39	4.5463

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965186:40-513(-)

Full Sequence      

MSVSTVLSIAVCIGPALVSAWYRPAVDTTWAIQYSGTYLDVSNPATVYDIDGFNATANLI
SGLHGAGHRVICYFSAGSIESYTPDAKQFPASVAGKVLDGWPDEKWLDVRQLSILRPLML
NRAQIAKDKGCDGLDWDNVDGY

Enzyme Prediction     

No EC number prediction in CCG84409.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	30	142	2.2e-36	0.5789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	2.09e-44	29	142	1	112	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	1.01e-18	48	142	83	180	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK98434.2|GH114	1.87e-40	19	142	41	162
UAB97319.1|GH114	1.24e-39	21	142	82	202
UAB96747.1|GH114	4.79e-39	19	142	25	147
AKH39392.1|GH114	5.09e-39	22	142	13	132
ADO71463.1|GH114	2.01e-38	16	142	77	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	3.43e-35	19	142	31	153	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	5.00e-35	19	142	48	170	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

CCG84409.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999766	CS pos: 20-21. Pr: 0.9668

TMHMM  Annotations     

There is no transmembrane helices in CCG84409.1.