CAZyme Information: CCG83932.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG83932.1
• CAZy Family: GH81
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740		83626.71	6.1767

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965147:26149-28545(+)

Full Sequence      

MAAPPDINYATKPKPVASTEDIYRRSDTSSQNDIFTRRISTNGPHLPYRSHDLQPKSVEP
CSTSGLPIQTNKFYANFLLGSQKSQVYALPYLLKWSGYGLDINHTDEEQRVFGPDDAQIN
AQYYFCPVGIVSLSLTAREQPRFLRLSETDQFSVNVTLQMGSDSQEMLSLPIVRGSAFVT
AHYQKLTPCITSDVMIRHVENIIVTENITKWRLILEDGKVWLIYAVGKESLRLEHHSNRE
MCARSTWSGLLQVAKLPRGDPAVERLFDYAAGTYPTTIELHGRVMDQARYSFKFNKVGAH
PVLAYALPHHIESFDDCMAQKTYRNALASQTNGSMTLVWADEWNMHAQLPNSNELTSCPV
IPDAYKPVIVATIEEDSRQDFDSQIRADSMYFCGKALNKLAQLTLLTAKVQSPSLHTLLT
KLESNILFFARNQQQYGLLYDQTWGGIVSSQGFINGDGSDFGNTWYNDHHYHYGYHIESA
AIFLELFPNSVARMEIERWVRDLIRDVASPVNDSWFCAYRAMDWFVGHSWSKGLYESADG
KDEESSSEDYNMSYAMYLFARVVGDTAMADRARLQLAVQRSSITAYMLFSEDNTTVPSQI
SQNRVSGIKFENKIDYTTYFGANKEYIHGIHILPISPITPFFRKQPNKVSLVTLLSLIGQ
PNFVRSEWLTKLGPLIEATPQMQPGWRGILYANLGLIEGPGGEAWRYFMDRVEVDGGQMS
MLDIGTACVALLFEASMRCG

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	54	717	1.9e-170	0.9758842443729904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	1.03e-175	15	698	24	721	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	7.86e-145	361	725	2	342	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.80e-100	55	353	2	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIU47332.1|GH81	2.28e-146	50	717	108	769
AIU47333.1|GH81	2.28e-146	50	717	108	769
AIU47331.1|GH81	6.61e-145	20	736	78	780
AIU47330.1|GH81	6.61e-145	20	736	78	780
QDS74901.1|GH81	2.07e-139	58	717	220	886

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.60e-86	28	718	2	706	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.90e-86	28	718	27	731	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.35e-83	28	718	2	706	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.81e-16	382	649	332	595	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.72e-15	260	649	245	619	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	5.22e-128	28	717	187	889	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	2.48e-127	34	698	7	668	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.21e-117	33	708	46	711	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.73e-109	39	698	406	1077	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	4.78e-105	67	698	110	744	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CCG83932.1.