CAZyme Information: CCG83860.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG83860.1
• CAZy Family: GH76
• CAZyme Description: alpha-1,2-Mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
886		97404.55	5.0176

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965143:16337-18997(-)

Full Sequence      

MAIRVSRRAKYLVVLAFISVLLYGSIETKQFDGLKLPQPSSILPLHAFDGTSGLLPKTAL
QDTSKATSANPDSGSDLEDTSIDSDVPGSEAGSAESLPGPPGVPASADAELSGQALSPAN
ADPKTNTVTPAQDTLTKVPANGQDALADQLAALQQDGIESPDKNLLPVSDTKKPSSHEKF
QLSRKENFPVPKNQLRHLPSDISAKIPTIQTVDPSLTETKSEKQVRLARQLEIRDVFKRD
WSAYKQFAWMHDELKPVSNKSNDPFGGWGATLVDALDTMLIMDLDDEYIEASAAVSKIDF
TYTSSKTIPLFETTIRYLGGLLGAYDLGVAKGKKDSVMLEQARVLGQVLYGAFDTPNRLP
SLKYNYRKQAESGTTMRAESEGVMSEAGSLSVEFTRLAQLSDGEDRHKYFDAIQRITDAF
EESIDYMEIPGLWPTKLDFSGCEPVKAAKPSPSAMPAQRSNAVSKLTKAAADDLGKVQQA
TDELLDILKTKGSVDKIAKGKVNKRQFLKDDDTASDDQSPSPVSPEPVCKKQGIRIPSKT
ASQTYSQGGQADSTYEYFTKEYLLLGGVDAAQQYKRLYEKSIDATTKNLLFRPLVPEDLG
ANQIMMSGDVIVSPGKGTKFHPKSQHLTCFIGGMYAMGSKVFSRPQDLELAAKLTDGCVW
TYDYTPTGVGPECFSVRECPDKACKWQDFVDKEAAEAAARNETPDWAAQVAIDRKASTDE
TAGIAKPESNVFRRQSPAIPNKAAALATTNFEQSQTTEAKAHTASQSQNDAAMFMVDSRY
ILRPEAIESVWYMYRITGDKSWQEKGWRMWQATESLTRTAIAHSAVTNLMDPQNVFYSDS
LESFWFAETLKYYYLLFSDFETISLDEWVLNTEAHPFKIVRTNHAV

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	237	879	3.4e-154	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	8.34e-171	236	879	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.46e-97	218	883	66	522	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX98421.1|GH47	1.68e-155	186	878	159	907
EGX51085.1|GH47	2.25e-149	186	878	177	1002
QGA16383.1|GH47	1.90e-144	133	878	114	918
QRD01632.1|GH47	7.38e-144	161	878	117	919
QLI67000.1|GH47	5.62e-142	185	879	186	1001

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HCU_A	2.40e-46	229	879	15	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
1KKT_A	3.76e-46	220	881	31	510	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	1.62e-45	233	881	9	475	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
5KIJ_A	7.41e-44	229	879	5	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	8.34e-44	229	879	10	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AV26|MNS1B_ARTBC	8.63e-51	233	879	44	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|Q0D076|MNS1B_ASPTN	2.92e-50	197	879	2	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	1.09e-45	203	882	19	513	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	1.93e-45	220	881	31	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|E9CXX8|MNS1B_COCPS	3.02e-45	206	879	23	514	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.826122	0.173887

TMHMM  Annotations     

Start	End
9	26