CAZyme Information: CCG83753.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG83753.1
• CAZy Family: GH71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		40426.63	9.4488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965136:24922-25977(-)

Full Sequence      

MRCFSRSITRPRACISPLWFLLLGTIITLATIGYNIIVFAKAVKLHTVSERDLPPGYQLA
LAESLLTVPCCRAANWTPSAHEVVIEQIPRIIHQTYKTRAIPEGDWQTAHNLCLNLHRKS
ENWRHILWTDETARRFIEHEYPEFLHVYDRYPYPIQRVDAMRYFILHHYGGIYLDLDIGC
ARSMESLLQFPAFLPKTTPSGVSNDLMASRPGHPFMLELGTSLQKQGGWVRYGTKYMTVF
FSTGPMFVNRILARYWQIARDPADRVIILPQNFYSESLTAYFMHFPGSSWHGSDAHGVMM
VYTHGWIVGVVLLAGYIGYSCRRAGATGQKRGNPRRRRRRSSDYEMCQTSE

Enzyme Prediction     

No EC number prediction in CCG83753.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	107	188	2.9e-22	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.68e-53	88	295	82	285	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.07e-22	105	194	3	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88228.1|GT32	3.09e-69	29	304	39	312
BAE56144.1|GT32	3.09e-69	29	304	39	312
QMW37845.1|GT32	3.09e-69	29	304	39	312
QMW25762.1|GT32	3.09e-69	29	304	39	312
UCK58225.1|GT32	1.52e-66	49	304	35	288

PDB Hits     

CCG83753.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	5.93e-59	88	321	55	289	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	9.16e-58	81	308	47	271	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.62e-55	88	319	82	307	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	1.97e-54	88	315	62	291	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.47e-54	85	295	61	266	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000003

TMHMM  Annotations     

Start	End
17	39
298	320