CAZyme Information: CCG81834.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG81834.1
• CAZy Family: GH135
• CAZyme Description: Beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481		51411.35	5.0291

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965059:77572-79017(-)

Full Sequence      

MMIINLLLQLPLQAAIAQQTFSGSNSVPDVTLLIDNPGTNSSTTIRTLLDAVSAKRGSPF
LFGVAYDSSSNTKLNNYAISRLNDTFNLGVAENNCKWVYTEPSRNVSDLTACKQSRDLFT
NHSASFRLHNTFWHQQTPSWLPGEFSASELVNDIIPVHVKQEAGGMGNYVSVDVLNEIVG
DSVTSGMSAYDCVANKMSWPTTRSDTDSTPFVTDLSWVESALRAAAQSTNATLLLNDYST
GGNNSKTECYYTLARALQGDGVPLGGIGFQSHVAAKANNFDSKGAVKATFARFASLGLAC
AITEFDVWLQDNSTQSLRWQAAIYGDYLDACLYSANCHEFLVWGLYDSVSWLTTFPDRGV
AMPLLFDANMVPKLNYYEVRARLQRYLDGSGEVCASASGNTACDLKQYATGPSSATAAAA
VSSVVGSSSRASATSARPTTGSSLPSQSANSAVSAGTSSLEARCSLWLALAAFGTTFLLS
T

Enzyme Prediction     

EC	3.2.1.8:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	57	380	3.7e-61	0.9636963696369637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	2.07e-55	49	381	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	9.90e-52	95	379	1	263	Glycosyl hydrolase family 10.
226217	XynA	1.01e-39	86	383	58	344	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJF69044.1|GH10	1.03e-37	93	380	74	341
QBI56661.1|CBM2|GH10	2.74e-37	86	383	83	359
AGK03520.1|GH10	1.97e-35	86	385	44	317
ALO06246.1|GH10	2.74e-35	62	380	47	343
CUM43505.1|GH10	2.74e-35	62	380	47	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VBR_A	1.01e-32	86	388	42	325	Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBR_B Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBU_A Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima],1VBU_B Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima]
3NIY_A	2.49e-32	86	388	58	341	Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NIY_B Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NJ3_A Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1],3NJ3_B Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1]
1EXP_A	2.33e-30	62	379	15	308	Beta-1,4-Glycanase Cex-Cd [Cellulomonas fimi],1FH7_A Crystal Structure Of The Xylanase Cex With Xylobiose- Derived Inhibitor Deoxynojirimycin [Cellulomonas fimi],1FH8_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Isofagomine Inhibitor [Cellulomonas fimi],1FH9_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Lactam Oxime Inhibitor [Cellulomonas fimi],1FHD_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Imidazole Inhibitor [Cellulomonas fimi],1J01_A Crystal Structure Of The Xylanase Cex With Xylobiose-Derived Inhibitor Isofagomine lactam [Cellulomonas fimi],2EXO_A Crystal Structure Of The Catalytic Domain Of The Beta-1,4- Glycanase Cex From Cellulomonas Fimi [Cellulomonas fimi],2XYL_A Cellulomonas Fimi XylanaseCELLULASE COMPLEXED WITH 2-Deoxy- 2-Fluoro-Xylobiose [Cellulomonas fimi]
3CUF_A	2.48e-30	62	379	15	308	Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellobiose-like isofagomine [Cellulomonas fimi],3CUG_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotetraose-like isofagomine [Cellulomonas fimi],3CUH_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotriose-like isofagomine [Cellulomonas fimi],3CUI_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylotetraose [Cellulomonas fimi],3CUJ_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylopentaose. [Cellulomonas fimi]
2HIS_A	1.46e-28	62	379	15	308	Chain A, CELLULOMONAS FIMI FAMILY 10 BETA-1,4-GLYCANASE [Cellulomonas fimi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07986|GUX_CELFI	2.15e-28	62	379	56	349	Exoglucanase/xylanase OS=Cellulomonas fimi OX=1708 GN=cex PE=1 SV=1
sp|Q60041|XYNB_THENE	3.97e-28	86	387	61	343	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
sp|P10478|XYNZ_ACET2	1.62e-24	80	386	547	837	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
sp|Q02290|XYNB_NEOPA	1.26e-23	86	376	54	318	Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum OX=4758 GN=xynB PE=2 SV=1
sp|P38535|XYNX_ACETH	6.10e-23	27	379	180	524	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000384	0.999574	CS pos: 17-18. Pr: 0.9557

TMHMM  Annotations     

There is no transmembrane helices in CCG81834.1.