CAZyme Information: CCG81822.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG81822.1
• CAZy Family: GH135
• CAZyme Description: Glyco_trans_2-like domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778		88599.45	5.8725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965059:42248-44684(+)

Full Sequence      

MPQTPMRFEGYPEKRDLRTLAEFLQCEVVLAVTSKSTAMLLKHLSPGIEVIPLDAMTNIQ
VLDSFADFVSLRRAQCAAFVREYNMLLIWSDRANSLLKFGQELEEKIVSLIWDEKYNREI
GQVIEKSTECIIKEKQVLFNDDQGPERSVALITPIAAAVSILAISAFIGLDLHEIILQIK
ADSNYVACGIVLYFPLMIWLASFFAQTFSIVLLQLLGPVSHLVSNTRGYSGVAPVRRKDF
ELPHITIQCPVYKEDLDTVLAPALATVKEAIKTYELQGGTANLFLNDDGLQLLDRHDADC
RQAFYKKYDIGFVARPPHGQEGYVRAGKFKKASNMNHALNLSYKLEEKLRDLHRTNPWND
TCEMMATESALSALLREENPPSLGGGDIRTGDLILLIDADTRIPSDCFLDAANEFNDSPS
VAILQHTSLAFQVVDNYWENCMAYFASFVSEAMRFMTAGGDVCPFIGHNAFIRWSALQEI
AVLDNDKRRWWSEVHVSEDFELSMRLQTEGYCIRMAAYSNGDFKEGVSLTVYDEFNRWQK
YAFGISELIFNPMRYWLIRSPFTPLFREFIMSRSINATSKFTMISYMGSYYAIGSAWLLA
FLNYFIIGWFQQNITNLYQSSFQILIATLLVYDVAVPVANAIYRYRSGQSGLLHAVYENM
KWIMLLCVFFGGLSIHVTQSLVWHLLGIPLQWDSTAKSLESSYYFNELPMVWRKYKYLYA
LILLIAITMIVLNTRIIPPTWRIQPSVFNSLPIAWVLACHASAPLLLNPQSWLSEIHL

Enzyme Prediction     

No EC number prediction in CCG81822.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	394	607	3.9e-41	0.8883248730964467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.47e-40	393	599	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	4.57e-12	390	636	137	362	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133043	CESA_CelA_like	1.51e-08	243	511	1	198	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133045	CESA_like	1.53e-07	390	499	78	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404520	Glyco_tranf_2_3	3.52e-04	390	539	87	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI60707.1|GT0	9.97e-207	24	769	131	872
QPC58384.1|GT0	2.99e-206	24	769	133	874
CZS80190.1|GT0	2.99e-206	24	769	133	874
CEF76899.1|GT0	2.99e-206	24	769	133	874
QGI83121.1|GT0	6.55e-206	24	769	136	877

PDB Hits     

CCG81822.1 has no PDB hit.

Swiss-Prot Hits     

CCG81822.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

Start	End
746	768
148	170
185	204
588	610
620	642
662	684
717	739