CAZyme Information: CCG81656.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG81656.1
• CAZy Family: GH128
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543		62306.40	7.5712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965054:94596-96227(-)

Full Sequence      

MDLSSMHRGNDQRTEEESREVLFTQEESYEMQAGAPYTEHLDLQHDDELESDSPVREAHA
RRNRAQAGLKYGVLRASAWVEEWTPWTMLVCYFAFSIFFYVTLPRSATKVFWYFYLFLAF
IVSTMVTIEASHCITPSKDARRAVRRLRETGQFPTPDEKLPTLDLVIVAYLPNEKDIIKK
QIRYALREIVYPKEKITVNVVYNTPHPIEPLETELQELCEQYVNLKVIKVTKSKSKADNL
NYFLTNEGNSDIIGIYDTDHYPHPHGPRWAAERFCRGDGTDIVQGRCVVYNYDESWVTKL
ISAEFDMIYAVFHPGRAHAQGFGLFGGANGYWRASLLKELKMQGHMLTEDIDSTLRAFAA
GAKMVHELNTVSYEQAPATVKAFTKQRLRWAQGWFQVTIRHATLAARQGAPGANIKSRFG
IFVLLVFRELFFYILTQFSALLLGNFVVQPPKDIASVYHALFGYPLSAWILIYNVLTLVI
ITGFTIRNRSEFTSWATICVYGAGMPIYFTILAAMGLFSHFRELTKYEKWNPTARSTVKK
EDA

Enzyme Prediction     

No EC number prediction in CCG81656.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	166	391	3.1e-21	0.9608695652173913

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224136	BcsA	9.53e-33	110	537	10	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	7.78e-32	165	350	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133049	CESA_like_2	7.43e-23	161	401	1	240	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
133043	CESA_CelA_like	1.71e-20	161	397	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133059	CESA_CaSu_A2	6.58e-18	171	393	7	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX64810.1|GT2	6.56e-160	77	539	15	480
CBQ69170.1|GT2	9.29e-160	77	539	15	480
CDU22257.1|GT2	1.32e-159	66	539	4	480
CDI55222.1|GT2	1.72e-157	77	539	15	480
SAM84173.1|GT2	9.78e-157	77	539	15	480

PDB Hits     

CCG81656.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P96587|YDAM_BACSU	3.47e-12	158	393	46	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

Start	End
84	103
110	132
425	447
460	482
497	519