CAZyme Information: CCG81475.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG81475.1
• CAZy Family: GH125
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		56789.34	5.6290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965050:59269-60747(+)

Full Sequence      

MLKPPTQESLPAELKRVSSAQFKAFQQGLPSSIKDSGFWTKTIHIRRLGRIRIWPLVVML
SSLLTFFSISYITDTYNPFTSNLAIERPLNQTVDAPFLEGCQDPTKAAAEHPRENAAFVV
LARNKEIGGVLSSMSYLESHFNQWFNYPYVFLNNEEFDSNFKRKVRNATDAEVEFGVVGA
DAWGFPEWVEDLDELKESIAQQGDRAIMYGGLETYHHMCRFFSGFFFNHPLLLKYDWYWR
VEPDVKFFCDITYDPFRFMAEQGKVYGFVIAIKELVETVPNMFRYASAWKRKKNLHSTGM
WDMLLKPKEEMKADSATTAKLPKEILQHDPIKADDKSHQISPDSMEGEAYNMCHFWSNFE
IARLDFFRSPEYMDFFEEMDLTGGFWRERWGDAPIHSLGAGLLLEPEQVHYFRDIGYQHT
DIFHCPANAPGKQLKRPANADGSRNDKGWDRPKKNGPGCRCECPTDLPEVESKEGTCINE
WADVIGGWLDTR

Enzyme Prediction     

No EC number prediction in CCG81475.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	113	420	8e-122	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	1.78e-149	56	487	19	392	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	2.85e-107	113	419	42	311	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19244.1|GT15	8.05e-178	87	488	91	496
UNI22923.1|GT15	2.81e-177	87	488	97	502
UKZ53076.1|GT15	4.60e-177	18	488	19	496
SCB64477.1|GT15	6.26e-177	87	488	96	504
EAA65264.1|GT15	6.31e-177	87	488	91	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	1.06e-85	113	426	26	301	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	1.12e-71	108	430	61	353	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	1.23e-64	121	426	110	388	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94565|OMH4_SCHPO	2.01e-143	87	490	65	439	O-glycoside alpha-1,2-mannosyltransferase homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh4 PE=3 SV=2
sp|Q96WW1|OMH5_SCHPO	2.82e-133	87	490	57	420	O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh5 PE=3 SV=2
sp|P40504|KTR7_YEAST	5.38e-113	94	487	66	484	Probable mannosyltransferase KTR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR7 PE=1 SV=1
sp|P53966|KTR5_YEAST	1.76e-112	94	485	63	490	Probable mannosyltransferase KTR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR5 PE=1 SV=1
sp|P27809|KRE2_YEAST	8.92e-84	113	426	120	395	Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999955	0.000051

TMHMM  Annotations     

Start	End
51	73