CAZyme Information: CCG80989.1

Basic Information

• Species: Taphrina deformans
• Lineage: Ascomycota; Taphrinomycetes; ; Taphrinaceae; Taphrina; Taphrina deformans
• CAZyme ID: CCG80989.1
• CAZy Family: CBM21
• CAZyme Description: Cellulase domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	HE965040|CGC2	48285.74	5.8167

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TdeformansPYCC5710	4680	1097556	17	4663

• Gene Location: location=HE965040:51354-52685(+)

Full Sequence      

MRLSIALTCARVLLTSSGVSAHAILAKRLFGLSFTDVATTSTVASTSIPHATPSTTPTTG
ATSTATTSVVPVTPSTKQKATENKFWQTFEARGVNLGNWLVLERWMDTAYYDDYSSAGTD
EWTFCQTLGADRCAEVLAQYWDDWITESDISQVADLGYNLLRIPIGYWALVPTTSDEPYV
YSSQLEQMERVMSYASTLGLHVVFDIHGLPGSQNGKEHSGHAGPIDWFSDTNQKRSLSVV
TAAMNFIYASPYRSVIAALEIANEPNITTSSARSTYEKYLTSATKIVHSINASMPIMFHD
GFQGADSWSKFTKNSKDNYVVDVHEYFTASTSNSISALSGACQLAATRSKSSSKTPVFVG
EFSVSVGGVYFDTITWRKQFYETQVQQYSRKGMAGSAFWSIKAFETNSSTTQNNGWSVQA
LADAGGITSDTWSLSNALTCPSS

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	139	365	1.7e-59	0.759075907590759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	7.01e-34	92	416	19	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.71e-14	142	404	22	271	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10323.1|GH5_9	6.26e-53	74	363	24	310
BCR97869.1|GH5_9	6.26e-53	74	363	24	310
CAK43212.1|GH5_9	2.40e-52	74	363	24	310
EAL88072.1|GH5_9	3.64e-50	92	326	43	271
ADV20345.1|GH5_9	3.43e-49	90	401	41	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1A_A	1.12e-38	86	425	17	367	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6LA0_A	3.17e-38	74	427	2	364	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
1EQP_A	1.27e-37	92	326	10	249	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	1.93e-37	92	326	15	254	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	2.44e-37	92	326	10	249	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	4.26e-53	74	363	24	310	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	5.82e-53	67	326	17	270	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	6.46e-51	92	326	43	271	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	6.46e-51	92	326	43	271	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	6.46e-51	92	326	43	271	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.611535	0.388468

TMHMM  Annotations     

There is no transmembrane helices in CCG80989.1.