CAZyme Information: CCE33856.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE33856.1
• CAZy Family: GT31
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:M1W512]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586		65904.66	5.9057

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000068:29334-31200(+)

Full Sequence      

MFTHMQCPPPRRYTTALVILILVTIFVWQGWTATQLPLRLPSSTSPLSASSPHGHRNATF
VPSTIDWSKAKIFHPPNGTVPLPSGTPKTLPRVQHRTASQGRPGTTVARKEAIRKAFIKS
WKAYKKHAWGRDELMPLSGKGKTTFSGWSAQLVDALDSLWIMGLKDDFYEAVQEVAKINW
SEHDGSTINVFEVTIRYLGGLLSAYDLSQEDVLLRKAIELGDALYMAFDTPNRLPTHWLS
YTKAQAGDTTGDVSISGAASGSLCVEFTRLSQITGDPKYYDATERVKQFFYEHQNHTKAP
GLWPWDMDFRHGTIRDGFFTFGAGADSQYEYLPKMYALLGGLDPQYADMTTTALDAGRRD
LLFKPMTPTDEDILMSGNMDVSAAQRDPEASMQHLTCFVGGMYALAGKLMRRDDYIQLAG
RLTAGCVWAYDSFETNVMPESSTLYKCPEMDAPCPYKEDVFAARGSGSDLPGGFLRTDDT
RYMLRPEAIESVFYMWRVTGDVTWREAAWRMWEGIVREAETELAFATMSDATRRGSHKVD
TMETFWLAETTKYFYLTFEDESVLSLDEWVFNTEAHPVKRPIDGAT

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	116	580	4.5e-155	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	116	580	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	4.05e-117	109	581	72	519	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	5.09e-05	93	303	367	582	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
271200	LanM-like	0.006	105	305	510	694	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG96609.1|GH47	0.0	1	582	1	577
QLI63719.1|GH47	0.0	9	582	9	568
QUC20359.1|GH47	4.28e-303	1	581	1	570
UNI15842.1|GH47	3.82e-257	61	581	52	577
UKZ46500.1|GH47	2.61e-247	1	581	1	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	5.81e-69	103	578	34	506	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	9.21e-69	108	578	4	471	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1X9D_A	1.12e-67	63	578	43	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KIJ_A	1.10e-66	109	578	5	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.28e-66	109	578	10	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9CXX8|MNS1B_COCPS	2.66e-75	99	579	35	513	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|A2QAS2|MNS1B_ASPNC	6.61e-74	105	579	38	509	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	1.02e-71	105	579	38	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|D4AV26|MNS1B_ARTBC	5.15e-70	111	579	42	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	1.44e-69	102	579	33	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000027

TMHMM  Annotations     

Start	End
13	32