CAZyme Information: CCE33811.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE33811.1
• CAZy Family: GT25
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	CAGA01000067|CGC1	51184.77	5.1433

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000067:20223-21659(-)

Full Sequence      

MRMKDPDLARLFENAYPSTTDTTIKFHTSGKDTGFMRFGGSRTALDDGAWEGPQTFIITG
DIIAEWLRDSTNQLRPYQALATKDAAIRTLILGAINTQSEYVIESPYCNAFQPPPISDLP
ITSNGQDDDVHPVYEPNAVFECKYELDSLAHFLALANDFYQHTGSTDFVNERWILAVETL
LYVLDQQSRPTFDSETRTALGNDYTFQRWTNIGTETLNLQGNGNPLNSGTGLVRSAFRPS
DDATILGFFIPANAMMSVELQRAAKVLTVAGKMSLAQKLQRWSATLRSAVLEHGVVTHKK
YGDIFAYEVDGYGSSILMDDANYPSLLALPVMGFCEIDDDIYQNTRRMILDRLGNPYYLV
GKDVSGIGGPHIGLRNAWPMSLLIQAQTSQDDAEIERCLGMVLRSSKLGLIHESVNVNHA
KHYTRSWFAWANGVFASTILDLAKRKPHIIFSPGTAPYEP

Enzyme Prediction     

No EC number prediction in CCE33811.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	5	440	2.2e-161	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	5	440	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	6.03e-162	4	448	23	428	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
225922	SGA1	0.002	246	432	412	594	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH04599.1|GH125	3.70e-293	3	460	1	477
QLI70488.1|GH125	1.05e-280	2	460	83	541
ANH56436.1|GH125	1.18e-272	2	460	83	540
UNI20401.1|GH125	2.21e-269	2	459	87	544
UKZ90116.1|GH125	4.25e-266	2	459	84	540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	3.06e-88	8	442	52	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	3.71e-87	8	442	72	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	3.95e-86	3	442	45	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3QPF_A	1.41e-71	2	441	18	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]
6RQK_A	1.74e-67	2	446	22	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	3.26e-161	2	450	74	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CCE33811.1.