CAZyme Information: CCE32177.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE32177.1
• CAZy Family: GH72
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:M1VX04]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475		51908.50	6.1654

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000038:215562-217116(-)

Full Sequence      

MKFVKSVHAVATLGGIYAPKDIDVDSQTSVRNVAATLAHETMSYYVGNTTDPKSREFGNV
VKPYYWWVAGALWGTMLDYYHYTTDPSYNGVVLQALLAPTNLGIGHNFMPAEHSDEEGND
DLFFWGSAVLSAAERNFPQPNDSLPSWLDISVNVFDQLASRWDTKYCNGGVFWQILASNP
NGLKYKNSVSNGGFFQLAARLGRATGNETYLNWAEKIWDWNAQVGFIDSQSYRVYDGAGI
DTGCAKVNKKSFSYTTGIFLYGAAIMAEQTGQDKWAQRTEKLLDEAGNFFFTGKDKNIMW
ETECEPTSTCNYDMVTFKAYLSRFMWQTAHVMPSLRAKVERLLIPTAKAAAATCTGGKTG
HACGGKWYVGGFDNAASFGGAMCAQEAIQGLLAKDSALPLKGKDIKWVKDASFTPLDTYA
SSETRRDVTPPASQAPPTPAASQPSDKGPSLSAGNVATGNWPLLMMSISLALCLL

Enzyme Prediction     

No EC number prediction in CCE32177.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	25	398	1.2e-87	0.9497206703910615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.34e-136	29	384	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	4.99e-04	64	277	44	232	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG94756.1|GH76	1.21e-293	1	467	1	467
QLI64344.1|GH76	4.30e-258	1	467	1	472
QUC22573.1|GH76	6.37e-237	9	465	14	492
UNI21853.1|GH76	1.82e-207	1	471	2	474
ANH56506.1|GH76	5.68e-203	62	466	14	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	4.40e-80	24	399	30	410	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	6.38e-100	1	399	1	389	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	7.30e-97	21	431	23	420	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|P36091|DCW1_YEAST	3.85e-96	10	399	7	392	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	2.29e-92	22	399	21	395	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	2.34e-89	22	404	22	396	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998165	0.001857

TMHMM  Annotations     

There is no transmembrane helices in CCE32177.1.