CAZyme Information: CCE31706.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE31706.1
• CAZy Family: GH55
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:M1W2B2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	CAGA01000033|CGC1	42520.20	5.6443

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000033:240405-241574(-)

Full Sequence      

MHHPFAFLTTAQCFALATTALAAATPISDSKCTCYLTNGTEPAFYKAHRFFDFRDLTDYA
SSNGPDVLPSVQDTSSAPPTSSFFTSDLWTSTWQTQSWNNSKPGKLNGDATILMVNSPNN
IYIQAADTHDSASPPSSTYLTLRTSRQRTFQSSSEFQAVSSAYYYLSLRMLARTTGSPGA
VSAVFTYRDAKTLPEIQEADMEIVTRGPKNRVQYTNQPSYTTDGSGGGDVIARASRNATL
PHGKTWSDWAVYRLDWTPKQSVWYIDGQQVASIAFQVPRDPAGIHVNSWSDGGSWSGNMS
VGDQASLQIQWIEMLYNTTEKTTEKRDEDASSGDDQGCRVVCSIDEAPQVGAAAKLWGVE
SSQAVMPVRGGRRALLLCWVVSLVLAQTV

Enzyme Prediction     

No EC number prediction in CCE31706.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	91	314	5.2e-94	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.81e-52	83	314	3	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	5.79e-06	151	312	20	167	Glycosyl hydrolases family 16.
185684	GH16_lichenase	3.64e-05	163	312	68	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	9.80e-05	160	316	113	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	1.42e-04	201	273	119	184	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH02276.1|GH16_22	6.70e-184	1	376	1	386
QLI63560.1|GH16_22	1.61e-140	27	364	24	363
ANH56407.1|GH16_22	5.90e-134	27	364	28	377
UNI14008.1|GH16_22	2.69e-128	27	367	31	389
CEF84700.1|GH16_22	5.48e-118	16	366	13	368

PDB Hits     

CCE31706.1 has no PDB hit.

Swiss-Prot Hits     

CCE31706.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999766	CS pos: 22-23. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in CCE31706.1.