CAZyme Information: CCE31197.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE31197.1
• CAZy Family: GH47
• CAZyme Description: Chitobiosyldiphosphodolichol beta-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:M1VWF8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	CAGA01000028|CGC1	53818.63	8.9172

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000028:339874-341523(-)

Full Sequence      

MQLLAFLLSMLGGILFVFAIKFGVKTLVKLIYGLPRAIPSRYRPPRRPEDNHIQILVLGD
IGRSPRMQYHALSVARHARNVEIVAYKETSRHPDLIGNERVTMYALAPQPEWIVWGTLPF
FLNIPCKVIQQFWTLFYTMMWATPAAQWIIIQNPPSIPTFHVALLVSLIRGSKVIIDWHN
YGHTILAQKPLYALFVPLYKWYEIMLGKFLGNANLAVTHAMARELRGRAFNLRNPVYTLH
DRPAELFQPISSRNARRKFLERLPETKPHAQNIMDGHMRLIVSSTSWTPDEDFNILLDAL
VSYANPPNPNPNEDASSTEPPCPILAIITGKGPDKAKYLDLIQQIQDQGRLPGIKVLTAW
LSNRDYATLLACADLGISLHKSSSGVDLPMKVVDMFGAGLPVAAYSAFESFGELVKEGEN
GCGFETAAQLMAIMQRLFSEQGQDELAMLKKGAIREGSLRWDQEWDRVMVSVLGFSEG

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	51	470	1.3e-140	0.9905882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	8.33e-180	52	469	5	407	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	1.36e-128	52	431	6	368	transferase, transferring glycosyl groups
340831	GT4_PimA-like	9.62e-06	156	421	90	312	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340839	GT4_GT28_WabH-like	1.16e-05	146	456	76	343	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
340844	GT4_UGDG-like	9.07e-05	216	426	153	326	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG94736.1|GT33	2.60e-294	6	477	22	488
QLI64698.1|GT33	9.42e-280	5	474	4	468
QUC22591.1|GT33	4.35e-279	5	477	4	471
UNI21879.1|GT33	5.64e-247	6	473	5	466
ANH56527.1|GT33	3.90e-240	5	476	4	439

PDB Hits     

CCE31197.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZD1|ALG1_ARTBC	1.44e-99	14	474	6	444	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01551 PE=3 SV=1
sp|Q59Q79|ALG1_CANAL	1.06e-81	38	472	39	451	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG1 PE=3 SV=1
sp|O13933|ALG1_SCHPO	1.45e-79	46	473	20	420	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg1 PE=3 SV=2
sp|Q921Q3|ALG1_MOUSE	1.40e-78	52	477	34	465	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|Q9BT22|ALG1_HUMAN	1.87e-77	26	473	7	461	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000005

TMHMM  Annotations     

Start	End
5	24