CAZyme Information: CCE30486.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE30486.1
• CAZy Family: GH32
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:M1W130]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
894	CAGA01000022|CGC3	100300.00	6.3179

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000022:262031-264963(-)

Full Sequence      

MPRKRHKLIAVVALTILILLYRHLQSSWDAQQLKPVAWNDGQRPGGAPLSNIDKSHTLAS
GESQGDDGTSVDEKEELSSGSGPDGWSRNNVHTEVGSKSQDETEKVLGQTDEDHSSKLTS
DEVASPPATPTGRRWKKPKEHFPLPKESIITLPAGSAKDIPRIQHIFPTESEKLKEKRLR
RLTMVKNEIQRSWAGYKQYAWMHDEITPVSNRSRDPFCGWAATLVDSLDTLWIAGLKDEF
DEAAAAVKIIDFTYTNRSTIPVFETTIRYLGGLLAAYDVSGGASGHYSFLLDKAVELAEI
LMGIFDTPNRMPVLYFHWRPEDTSRPRRARRAGMAEIATLSMEFTRLAQVTGRHTYYDAI
DRITNALIDMQRTGTLIPGLFPEHLDITGCSVAAAIEQKLKSKASTKQADSASNLKERKD
DKLPRDDQLPNGVDGHDEELGCIAQGLVPVDNGYQEYHMGGGQDSAYEYFGKEYLLLGGK
ESKYQKLYEDTVDGINKHLLFRPMIPDDWDIIFPARVGIKADTNVVPNIEYEVTHLTCFI
GGMYALGGKLFGRQKDIEYAAKLTDGCVWAYQSTASGIMPESGYLVPCPTFKQCSFNETL
WRQALDPLADSRDQRILDWEAIESGKQMEQREKRKAERQKEDMVRVRTDRVGKVVSAEHN
TFSQTSFSSSHVALEKTSALEKRSVIPVTPSDPNLSTSRASDEEVNAVVAEKGLEYGATR
SQTRNKQVPEAKSELSALKEDNPRHSGPAKVPALKSHHSQRPRKPPTHQEFVEEQIQKGV
PRGFSSVSSKQYILRPEAIESVWYMYRITGDASWMEKGWAMFEATMKATRTPSANTAIAN
VLSQEHEPLDTMESFWLAETLKYYYLLFSESSLISLDEWVLNTEAHPFKLETKA

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	189	889	5.5e-165	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	8.85e-174	190	890	3	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.33e-81	125	890	30	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI67000.1|GH47	0.0	1	890	1	1001
QUC17127.1|GH47	3.57e-298	1	890	1	1012
ANH56411.1|GH47	5.22e-281	1	892	1	823
UNI17669.1|GH47	3.19e-275	121	890	151	971
UQC81050.1|GH47	1.95e-237	122	889	166	1024

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.23e-37	185	582	9	341	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	2.14e-37	185	582	44	376	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KIJ_A	1.28e-32	192	581	16	326	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	1.34e-32	192	581	16	326	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	1.40e-32	192	581	21	331	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P39098|MA1A2_MOUSE	2.05e-37	170	887	173	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|O60476|MA1A2_HUMAN	2.74e-37	139	887	151	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
sp|P31723|MAN12_PENCI	1.10e-36	185	582	44	376	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|B2GUY0|MA1B1_RAT	1.80e-36	192	894	218	657	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|A2AJ15|MA1B1_MOUSE	3.23e-36	192	890	219	654	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999957	0.000065

TMHMM  Annotations     

There is no transmembrane helices in CCE30486.1.