CAZyme Information: CCE30261.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE30261.1
• CAZy Family: GH30
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:M1W0Y5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	CAGA01000020|CGC1	72626.93	6.8449

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000020:371745-373652(+)

Full Sequence      

MGRSLLRRRTLTLVVVFVSLLLLLFRLSRTSLEYGLRAPDDVPEATRDADPLDTAIDMGM
EGENESHQIGYLTQPLRNPRPDIHPVEHLSQTAEHEFRATLDRQSKTLEEAVKEYRRRYK
LAPPPHFDKWVEFAMENKVQLVDEFDTIHELMTPFWGLSPRTIRSRAQEALGRDNGLLGI
AIRGHKVAFVDNAHGPEWQQEATTDMMARFLQYLPDMDLAFNIHDEPRVVLQHDDLARLV
RKATTEDMVSSFANPRPVNAFATSVPDLEATRFTKVKKTRFRAAAHQPTWTTSRMSCPPD
SAARILDDAALGDDAARYALTEAGFVANSTALADICLSPSLSQTHGFFDRPNGYNVAHDL
FPIFSQSKMSSYSDIIYPSPWYWSGKVTYNEAKDLSWNDKDAQLYWRGSTTGGFGRDGSW
KRHHRQRLVQKLTHAPQADVLEMETVGGGDQTHEAPSNGILRQIKRSEVDALLNVRFSHV
GQCDPADCQAQIKHFGVKDMVDMNDAWRYRFLLDMDGNAFSGRFYALLQSRSQVFKQAIF
QEWHRERLKPWVHYVPMSMRGHDWVELVRFYSSRSNTRAEAMARASSDWAGKTLRKVDME
AWFFRLLLEYARVVDDDRASIGFDLSSMDHRPAAE

Enzyme Prediction     

No EC number prediction in CCE30261.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	339	614	1.4e-78	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.88e-20	352	612	23	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	9.99e-10	362	612	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY64186.1|GT90	1.68e-226	84	631	80	623
UNI14246.1|GT90	3.03e-223	84	627	90	627
UKZ54826.1|GT90	5.27e-221	74	625	7	551
UKZ85843.1|GT90	2.81e-220	74	625	86	629
UKZ59411.1|GT90	8.28e-220	74	625	87	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	2.30e-09	362	614	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	9.34e-06	339	612	95	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.88e-41	27	635	106	677	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	2.18e-09	354	614	156	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.22e-08	362	614	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	8.43e-08	501	614	271	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	3.47e-07	362	614	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999945	0.000077

TMHMM  Annotations     

Start	End
5	27