CAZyme Information: CCE29650.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE29650.1
• CAZy Family: GH18
• CAZyme Description: Glyco_hydro_3 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:M1W530]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
927		101249.06	6.9500

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000016:19440-22726(+)

Full Sequence      

MAATSETSDLDPLWHNLDWAIGQMMIMGWDGTQVTPQIKSLIEDNHLGSIILTAKNLKSA
QETAQLVQELQIIAKNSGHPHPLLIALDQENGGVNSLFDEDYVCQFPSAMGVAATGRIEL
AYEISKATATEISACGVNLMLGPVLDVLNNTKPQPLGVRATGDDPQEVSQYGLAALSGVR
DAGLATAGKHFPSYGNLDFQGSNLDVPIITQTLEELSLSALVPFRNAIASGKLDAMFVGG
CGISNASMNVSHACLSDQVVEDLLRNELGFTGVAISECLEMEALSHDLGVQNGVVMAVEA
GCDLVLLCRAYDVQLEAIKGLKLGYDNGIITKQRIFTSLRRILHLKRSSTSWARALNPPG
VSLLSQIHSSHLSLSRQAYDESITVVRDKEKLLPLSNSMHPGEELLLLTPLVKPLPASAM
TRSLTESRKNGPKSVTKHDDWAHKERERSSIMSGEGVFRQFGRNLARLRNEKLLHTSYTA
NGVRPVHENLIHRASCIIIITADANRNMYQAGFTKHVDMMCSMHRSKGNKKQLIVVAVSS
PYDFAMDKSIGTYICTFDFTETALSALVRVLVGEIVPKGSMPGTVRKSKKVLKSRQHWLV
EEYDRTRDFAGLDDLLRRVHRASAPDLHFLKSTRAASFELYSPNIEENHFVVRNSSTGAL
YGFVSTYFVGGHGIIGALLVDPSKRNVSIGRSLHKRALKSIGEQKGLEKVKIGMCFPGVF
LGVPLDIEANTVKEWFSNSGWDTQFPRRLTNMIINDLPNWTSPDGLLQRLQTISISFDLI
HGLENAECVSHHVRANANPEVHELYTRALSESNTCGVVRAKDPFGSLVGTVIICRRASAL
ATCIPSLLSDHGDVGGIIAPIVMSSPQATLILQGLALMGIRQSKNQKCSMAVLSWVVDDA
YEPLVAMGFDILQSFEEITNSPDICRS

Enzyme Prediction     

No EC number prediction in CCE29650.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	306	2e-47	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.71e-65	21	396	7	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.47e-53	17	345	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	9.50e-33	31	372	10	337	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG94428.1|GH3	0.0	3	924	9	930
QLI67752.1|GH3	0.0	2	927	14	939
QUC21106.1|GH3	0.0	3	926	15	938
ANH56442.1|GH3	0.0	4	925	15	987
UNI22598.1|GH3	0.0	1	926	1	927

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	5.56e-95	16	833	8	769	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.27e-60	21	582	17	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	6.99e-42	16	582	43	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	9.31e-42	16	582	17	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.34e-41	16	582	47	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	3.60e-41	16	582	43	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|B2I6G9|NAGZ_XYLF2	2.73e-32	24	320	1	292	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1
sp|Q87BR5|NAGZ_XYLFT	2.73e-32	24	320	1	292	Beta-hexosaminidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=nagZ PE=3 SV=1
sp|B0U3L0|NAGZ_XYLFM	3.69e-32	24	320	1	292	Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) OX=405440 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	6.77e-32	24	324	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CCE29650.1.