CAZyme Information: CCE29293.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE29293.1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	CAGA01000013|CGC1	39614.93	6.5464

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000013:196554-197762(-)

Full Sequence      

MSHSLTSATIKVILSLAVFLTSLQLLSYFYTPSIGYVRPRLAKTTYAAELLTRTPSRTPG
VVPKIFHQSWKSLELPTKFQEWSLSCRQKHKGWEWVVWTDEDNLRLVQQHFPWLEDVYNG
LPGVIYRADLARHLYMYIYGGVYADLDTECLHPTEDLQHEYGPIFGKSKTPLPDRAIFGR
MGTNPDFEHSIPNAWMAATPGHPFFLLAIQHVMSIYNETKSQNKIGTPESVTGPIALRDS
IIKYEEDKIRQGPALGDSIKYLTSVGPFAQDQAENHEVLLLPSHLIYPYSWAYGGEDVRG
DCWVLHDTYNAETCKEKLGTEQAGSICITYWSHTHAGAGHSKENMEHIN

Enzyme Prediction     

No EC number prediction in CCE29293.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	80	158	4e-17	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.50e-21	62	246	82	245	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.81e-14	85	157	10	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI72987.1|GT32	4.04e-151	9	348	9	358
UKZ71055.1|GT32	2.28e-93	40	348	75	370
ANH56535.1|GT32	7.24e-88	39	348	81	376
AEO66576.1|GT32	5.20e-84	48	348	84	410
BCS10897.1|GT32	8.31e-51	42	334	58	370

PDB Hits     

CCE29293.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	4.01e-25	62	255	64	243	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	2.38e-21	61	262	81	260	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.45e-20	56	212	51	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	2.40e-18	59	210	52	184	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.21e-16	59	210	59	191	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000004

TMHMM  Annotations     

Start	End
12	34