CAZyme Information: CCE28450.1

Basic Information

• Species: Claviceps purpurea
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Claviceps; Claviceps purpurea
• CAZyme ID: CCE28450.1
• CAZy Family: GH132
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
774		87769.04	10.0316

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cpurpurea20.1	8979	1111077	156	8823

• Gene Location: location=CAGA01000008:722322-724859(-)

Full Sequence      

MTMLLVVSTARASFSSTNGISALANRLLPGHGDAFEFKLTTAHENWSRWNPPVNDNYTVR
AGKKRKIRIEGTSLNALARGLRHYANDVLQSDHFFFIDRPIKAPKTLPVPAKDLKGASVV
PWRYNLNTVTFSYTFAWWQWKDWEKFLDWAALRGINLQLAWVGYEKIFLDSFRELGLKDE
DILPFFSGPAFQAWNRFGNTQGSWGGKGGLPLGFIEQQFNLQKKIVARMVELGITPVLPA
FPGFVPKCIKKVRPNVNLTTSPNWFPPAPDKYTRDLFLSPLDGTYAELQKLFIDKQMAVF
GNVTNVYTLDQFNELNPASGDTKYLSDISNSTYNGLTAANPAAVWLIQGWLFYSSRDFWT
QRRIDAYLGGVADDQGMLILDLWSEGNPQWQRTKNYAGKRWIWCQLHGFGGNMALEGRVQ
TITKGPLDALSLSKSLVGFGLTPEGFEGNEIVYDILLDQAWATSPLNTQHYFHDWTTRRY
SMTGATPPRELYEAWQVLRSSVYSNSRSDIPQVPVATYQLRPALSGITNRTGHFPHPTAL
HYDPRVLQKAWQLMFKSSLRQTHLWSSPAFQFDFLDLSRQMLSNAFDLRYSGLVRSYHCK
ISKPSKSHELRAVSPPKDAKCDVRAAGGSLLGLLWMLDYVLSTNAHFTLQRWTAGARKWG
TLSGGHEELFALNARSQVTVWQVNARDLNDYAAKAWSGLVASYYGERWRIFVNELVRASS
RRQKVDERALAKALGRFEADWQGGKGGEEGARKVKMKRFVRELMQGIPDVFSMA

Enzyme Prediction     

No EC number prediction in CCE28450.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	64	745	6.8e-187	0.9653092006033183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	4.37e-175	123	461	1	331	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	4.37e-76	471	742	1	239	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	4.40e-18	18	108	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG98893.1|GH89	0.0	4	771	12	767
QLI71144.1|GH89	0.0	12	771	21	771
QUC15829.1|GH89	0.0	9	774	23	786
ANH56491.1|GH89	0.0	16	742	26	784
UNI23902.1|GH89	0.0	10	772	18	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	5.76e-116	20	716	9	660	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	3.36e-83	54	741	201	846	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	3.82e-83	54	741	209	854	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	3.36e-82	54	741	224	869	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	2.74e-115	20	716	32	683	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	3.18e-110	23	718	52	754	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998696	0.001349

TMHMM  Annotations     

There is no transmembrane helices in CCE28450.1.