CAZyme Information: CC1G_15259-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_15259-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	AACS02000010|CGC6	44483.23	4.4187

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000010:361105-362428(+)

Full Sequence      

MKLSRALTLAAVATAATSTVVDSEDSVALWGQCGGVSSTFLLHLAREAHISFDWKAGHSG
PTQCADGSHCVTVNAAYHQCVPLPSILNWVSTGPLVGPKNDSRQVAGIKDPSVVYHEGTW
HVFATSAKSGNWSMLYFNFTDWSEANDAEFFYLDQSGIGPGYRAAPQILYFAPQKLWYLV
YQDNNAGYSTNPDISNPAGWSTTKHFYDEVPQIVRDNIGDGYWLDFWVICDAAKCHLFSS
DDNGQLYRSETAIADFPDGFNEPVIAMQEANRFDLFEGSCVYRIDGSDKYLLLVEAIGSD
NRRWYRSWTSSDIAGPWEALADTESNPFARANNVDFEDGKAWTKDISHGELIRSGYDQSI
SIDPCKLQFAYQGLDPEAEANVPLYGNLPYRVALLTQTNSSC

Enzyme Prediction     

EC	3.2.1.55:25	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH62	83	366	2.4e-112	0.9892086330935251

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350101	GH62	1.65e-167	83	397	1	304	Glycosyl hydrolase family 62, characterized arabinofuranosidases. The glycosyl hydrolase family 62 (GH62) includes eukaryotic (mostly fungal) and prokaryotic enzymes which are characterized arabinofuranosidases (alpha-L-arabinofuranosidases; EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose side chains from xylans. These enzymes show significantly different substrate preference with rather low specific activity towards natural substrates and differ in catalytic efficiency. They do not act on xylose moieties in xylan that are adorned with an arabinose side chain at both O2 and O3 positions, nor do they display any non-specific arabinofuranosidase activity. The synergistic action in biomass degradation makes GH62 promising candidates for biotechnological improvements of biofuel production and in various biorefinery applications. These enzymes also contain carbohydrate binding modules (CBMs) that bind cellulose or xylan.
281639	Glyco_hydro_62	2.36e-58	83	365	3	271	Glycosyl hydrolase family 62. Family of alpha -L-arabinofuranosidase (EC 3.2.1.55). This enzyme hydrolyzed aryl alpha-L-arabinofuranosides and cleaves arabinosyl side chains from arabinoxylan and arabinan.
350092	GH_F	2.38e-17	109	373	1	250	Glycosyl hydrolase families 43 and 62 form CAZY clan GH-F. This glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) includes family 43 (GH43) and 62 (GH62). GH43 includes enzymes with beta-xylosidase (EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanases (beta-xylanases) and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. GH62 includes enzymes characterized as arabinofuranosidases (alpha-L-arabinofuranosidases; EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose side chains from xylans. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. GH62 are also predicted to be inverting enzymes. A common structural feature of both, GH43 and GH62 enzymes, is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
197593	fCBD	1.03e-05	28	81	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.19e-05	29	77	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK14423.1|CBM1|GH62|3.2.1.55	1.27e-172	30	402	26	397
AVT28356.1|CBM2|GH62	3.09e-164	83	402	155	470
BCJ62406.1|CBM2|GH62	4.30e-164	85	402	177	490
AVT38405.1|CBM2|GH62	7.16e-163	83	402	155	470
SCG75834.1|CBM2|GH62	9.12e-158	83	402	162	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B6S_A	2.36e-166	83	402	1	316	Chain A, Glycosyl hydrolase family 62 protein [Coprinopsis cinerea okayama7#130],5B6S_B Chain B, Glycosyl hydrolase family 62 protein [Coprinopsis cinerea okayama7#130],5B6T_A Chain A, Glycosyl hydrolase family 62 protein [Coprinopsis cinerea okayama7#130],5B6T_B Chain B, Glycosyl hydrolase family 62 protein [Coprinopsis cinerea okayama7#130]
4N2Z_A	1.68e-145	83	402	22	337	Chain A, GH62 arabinofuranosidase [Podospora anserina],4N4B_A Chain A, GH62 arabinofuranosidase [Podospora anserina]
4PVI_A	4.29e-129	89	397	26	342	Crystal structure of GH62 hydrolase in complex with xylotriose [Mycothermus thermophilus]
4PVA_A	1.40e-127	89	397	26	342	Crystal structure of GH62 hydrolase from thermophilic fungus Scytalidium thermophilum [Mycothermus thermophilus]
4O8N_A	1.34e-59	83	396	85	381	Crystal structure of SthAraf62A, a GH62 family alpha-L-arabinofuranosidase from Streptomyces thermoviolaceus, in the apoprotein form [Streptomyces thermoviolaceus],4O8O_A Crystal structure of SthAraf62A, a GH62 family alpha-L-arabinofuranosidase from Streptomyces thermoviolaceus, bound to alpha-L-arabinose [Streptomyces thermoviolaceus],4O8P_A Crystal structure of SthAraf62A, a GH62 family alpha-L-arabinofuranosidase from Streptomyces thermoviolaceus, bound to xylotetraose [Streptomyces thermoviolaceus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23031|XYNC_CELJU	1.13e-71	79	395	319	615	Alpha-L-arabinofuranosidase C OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynC PE=1 SV=2
sp|Q5B9Z8|AXHA1_EMENI	1.06e-59	79	396	27	325	Probable alpha-L-arabinofuranosidase axhA-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=axhA-1 PE=3 SV=2
sp|O54161|EABF_STRCO	3.11e-58	83	396	178	472	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=abfB PE=1 SV=1
sp|P96463|EABF_STRLI	6.09e-58	83	396	178	472	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans OX=1916 GN=abfB PE=1 SV=2
sp|Q2U7D2|AXHA_ASPOR	3.60e-57	66	396	9	325	Probable alpha-L-arabinofuranosidase axhA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axhA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000539	0.999422	CS pos: 23-24. Pr: 0.3341

TMHMM  Annotations     

There is no transmembrane helices in CC1G_15259-t26_1-p1.