CAZyme Information: CC1G_14674-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_14674-t26_1-p1
• CAZy Family: PL14
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787		85525.06	5.0356

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000005:2171724-2175242(-)

Full Sequence      

MPQSIDIDATLLKLSIREKIKLLTGKGYFLTDFPGTHLLLAPTINIHRNPLGGRSSEFYA
EDPHLNGFIASAYINGVQSKGVACTIKHFVANDQETERFSISSEVGERALREVYLKPFQI
VIKHAKPWALMTAYNRVNGVHVSEDEHLLDDILRKEWGYEGLIMSDWNGVYSTTASIKAG
VDIEMPGPTVMRGKAIERALTAEKLFISDIDARVKQILGLYKRAQESGIPFDGPEEYNQD
PGVKNILREAAAESIVLLKNDKGILPLTNTVKKIAVIGPNAKVGVPSCGGSARVRSAYTV
SPLQGISAAAEKIGAEVGYSLGASAHRYLPTIGPYMSQPGILLEFWNEKPSPDFLSTQPN
LGDRLSSPAWTTTAHDTECFLVDGVEESKVNLTCWTRYTCTFIPDEDGDWEFELSIAGVG
NLFFGGQLVIDLSTNPPLGGSWFDLGTKEVQTVVSGLKAGTTYQIEIRTSSEDFVDRGPP
FPCWGGLRLGAARKIDHQRLVEDAVGLAKDSDVAILVVGLNNDWESEGYDRTDLGLPGNT
SELVAAILEANENVVIVNQSGSAVTMPWANSASTILQAFYGGDELGNALADVLFGVVNPS
AKLPLTFPLRLGDVPSHGSFGTVVQEPGKVLYNEGIFVGYRGYEVKQVKPLFPFGFGLSY
TRFSYTDLSISAIASGGNFDVSLKIKNSGDRDGKEIVQVYISNKASQLAQLVKELKGFVK
VYLKAGETKAVKVSLDKEALGYYDSRRRQWVAARGTYEVRVAASSGVDEAALAATIELEN
EIVWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	186	6.3e-53	0.7222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.04e-80	41	771	156	756	beta-glucosidase BglX.
224389	BglX	1.88e-63	35	316	113	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.14e-55	255	640	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.17e-42	41	736	155	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.92e-29	35	220	118	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL27551.1|GH3	0.0	1	787	1	847
CDZ97665.1|GH3	5.45e-256	35	787	94	837
CDR42254.1|GH3	1.82e-244	37	787	101	851
QRW26513.1|GH3	5.17e-204	35	784	99	858
UPK92097.1|GH3	4.91e-201	35	787	105	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.54e-183	38	787	97	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.44e-179	38	787	97	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.32e-112	38	765	103	657	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.17e-96	38	781	104	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.24e-92	35	765	111	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	3.42e-199	35	787	94	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	4.84e-199	35	787	94	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	3.84e-198	35	787	94	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.84e-198	35	787	94	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	9.97e-196	35	787	94	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CC1G_14674-t26_1-p1.