CAZyme Information: CC1G_14477-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_14477-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: lysozyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478		47174.90	5.7470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000004:3016663-3018099(-)

Full Sequence      

MVSPPNLTHHVKREAHFKARLDSTARLIYRRDDVEARQFGDFLGGLFGGGGGGGGGGGGG
GILNTIGGLFGGGRNSDNGGGRILDAVGGLINGGNNNGEGSGAGRILDAVGGIINGGGNN
NNAEGGGGTAGRILNAVGGIINSGGNNGNNGEGGGGTAGRILDAVGGIINSGGNTNNNGE
DGGAGRILDAVGGIINGGGNNNNNGEGGGAGRILDAVGGIINGGNSNNGGQGNNGGGFLR
TIGGLFGLGRGSNNNAPAPAAPAPVPAPAPPAPAPEVPAPAPAPPAPEAPAAPAPGPEAP
PATQPGAQCSTSLPSINTATVNLIQEFEGFVASPEPDPIGLPTVGFGHLCRQPNCAEVTA
QGLSFPLSRAQAEQLLQSDVQTFTNCLARFIDDSVVLNENQFGALTSWAFNVGCGNVQRS
TLRRRLNAGQDPNTVAAQELPRFNRAGGRVLNGLTRRRNAEVALFQTPSNTVALPVCN

Enzyme Prediction     

No EC number prediction in CC1G_14477-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	316	461	2.2e-38	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	5.11e-52	321	466	2	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	2.70e-33	315	464	1	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381619	endolysin_R21-like	1.20e-30	319	464	7	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	5.60e-30	315	470	6	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
395766	Phage_lysozyme	5.65e-14	367	458	19	106	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS99898.1|GH24	3.63e-55	310	477	102	266
UKZ52746.1|GH24	1.92e-54	306	477	97	265
UKZ78548.1|GH24	1.92e-54	306	477	97	265
QDS76536.1|GH24	3.69e-50	306	475	103	265
QLI64717.1|GH24	5.79e-50	306	477	106	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	1.65e-13	321	465	57	193	Chain A, Lysozyme [Acinetobacter baumannii]
6H9D_A	5.41e-11	316	468	6	149	Chain A, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
7M5I_A	3.69e-09	321	465	14	153	Chain A, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
3HDF_A	4.55e-09	328	461	10	131	Chain A, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]
3HDE_A	7.49e-09	328	461	35	156	Chain A, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07540|ENLYS_BPPZA	1.76e-17	316	470	3	149	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|P11187|ENLYS_BPPH2	5.97e-17	316	470	3	149	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|Q37896|ENLYS_BPB03	1.19e-16	315	467	2	144	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
sp|P62693|ENLYS_BPPHV	1.10e-09	321	468	8	139	Endolysin OS=Lactococcus phage phivML3 OX=10746 GN=L3 PE=3 SV=1
sp|P62692|ENLYS_BPLC2	1.10e-09	321	468	8	139	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995194	0.004805

TMHMM  Annotations     

There is no transmembrane helices in CC1G_14477-t26_1-p1.