CAZyme Information: CC1G_13978-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_13978-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		47007.29	9.1717

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:2607718-2609225(-)

Full Sequence      

MSSTSWLPKPIASLLRFAYSLLTDPGHFWNLATLVILGDAFLTRLIVAYVPYTEIDWETY
MVQTNVFLKGQHNYSMITGPTGPLVYPAGHVRIHQFLYEITDGGKNMDLAQQIYGLLYIA
SLSLACLIYGSTRAVPNWLLLFLPLSKRLHSIFVLRLFNDCWAVVLSQMAIYALQQGYDD
TGVMLFSAALSVKMSVLLYFPGLFVILFKRKGLLRTLAYIMSIVAIQHIVAAPFLKVDAW
AYLQNAFDLGRVFLYKWTVNWRIFDEETFLSSEFAASLLFGHVFVLCAFGLYRWCEIDGG
VWTVITRGFKRPLLPAGIARVTPDYITTVLYTSNLIGIIFARSLHYQFYSWYAHSIPFLA
WKTKYPIALRIAFIGAIEYAWNIYPSTRLSSGILLAANTWILLGLWHGHATCTA

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	33	391	1.8e-132	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	33	391	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW13371.1|GT58	8.48e-141	10	408	14	413
QRW25746.1|GT58	1.54e-140	38	409	6	378
CCA69403.1|GT58	6.79e-139	20	413	8	408
QRV98819.1|GT58	3.17e-138	21	409	25	414
QRV84772.1|GT58	3.17e-138	21	409	25	414

PDB Hits     

CC1G_13978-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O82244|ALG3_ARATH	1.04e-108	35	406	39	416	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q55F69|ALG3_DICDI	3.53e-97	28	406	18	422	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|P0CN93|ALG3_CRYNB	9.07e-92	20	408	27	434	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ALG3 PE=3 SV=1
sp|P0CN92|ALG3_CRYNJ	9.07e-92	20	408	27	434	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ALG3 PE=3 SV=1
sp|Q8K2A8|ALG3_MOUSE	1.10e-90	19	406	33	421	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000005

TMHMM  Annotations     

Start	End
29	51
72	94
109	131
152	174
184	206
213	235
270	292