CAZyme Information: CC1G_13852-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_13852-t26_1-p1
• CAZy Family: GT76
• CAZyme Description: endo-beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689		76473.78	5.5067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:740179-742661(+)

Full Sequence      

MPVRGTVPQPRALPEYFQSFQELDDWRTSKTGPFYSAEGVRPYVPRRLRTEDITGQGRLL
IAHDFKVNTNERRLCPSIAVLTGPGSFAHHRITIPPPEWIASAHRQGVPILGTLGLHVLK
WNYGRMFEGEAQEDCFRMVIGTQPRNATVDDAPWSRANYTVPVSPHYAEILADIAKERGF
DGWLINIEMDLKGGSSQARGIAAWVSLFQQEVLKKVGSHGLVLWYDSVTFRGHLSWQERL
SSRNLPFFLSSSGLFTNYAWYNHFPQRQIDYFNSLDPKLLKGKSLQDIYAGIDMWGRGSH
GGGGFGMYKALEHADPQKLGLSIALLAPGWTWESENENPGWTWERFWEQDTNLWVGPSSS
KVAIEVPPTEFKVVEPMCEHGPFKPVSKFFPTLPPPDPLDLAFYTSFSPGVGHQWFVEGK
EVFYSGSGWTDIEKQTSTGDLVWPKPTVYNLVGGGLSDADASSALYFEDAWNGGNSLQIN
VTRTRGSTGYAGYWVPIQSLSLSTGNRYEASVVYKVGEGATGDVDAKLDLGVRGGGTRRN
AGFKLLEEDTTALASGWAKARIVFEPSAAEGEESIVPASIGFIVSVSSDSTKSSPSNNSF
LLPFLVGQIAVHPHLPADYHSFEASLYSLSFKRNATSRSPLDGMLSWDIVAALPEPPEPD
ESPDRDDPNLFWEVQPTERNWFPKPRTDG

Enzyme Prediction     

No EC number prediction in CC1G_13852-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	86	416	1.7e-55	0.8952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119364	GH85_ENGase	2.42e-70	87	435	39	325	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
397623	Glyco_hydro_85	2.42e-65	87	412	22	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
227068	COG4724	7.88e-27	85	478	118	445	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWP00370.1|GH85	9.74e-145	1	621	1	613
CDR49555.1|GH85	2.19e-53	5	519	8	543
VWO96094.1|GH85	1.02e-51	271	430	5	165
SHO78346.1|GH85	1.90e-43	10	484	13	469
CBQ71989.1|GH85	3.87e-42	8	595	37	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHA_A	1.35e-16	85	478	95	418	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	1.35e-16	85	478	95	418	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	3.15e-16	85	478	100	423	X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
2W91_A	3.69e-08	94	520	101	464	Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	4.28e-08	94	520	252	615	Crystal structure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SRL4|ENAS2_ARATH	2.21e-35	41	436	52	377	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
sp|F4JZC2|ENAS1_ARATH	6.28e-35	41	335	47	309	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
sp|Q8NFI3|ENASE_HUMAN	1.54e-31	16	555	86	538	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1
sp|P0C7A1|ENASE_CHICK	3.33e-29	87	503	162	486	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
sp|A1L251|ENASE_DANRE	2.35e-22	18	347	66	362	Cytosolic endo-beta-N-acetylglucosaminidase OS=Danio rerio OX=7955 GN=engase PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CC1G_13852-t26_1-p1.