CAZyme Information: CC1G_13811-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_13811-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608		67527.49	4.6273

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000001:4125330-4127718(-)

Full Sequence      

MVRQPFAFVLATLLPFVVTLVTGQVAQNVFEVHGDIVDEDYDFIIVGGGTGGSVLASRLS
ENADWKVLLVEAGPDNDGVQDLQIPYYWLRINSTYNWNYVNTPQVGLGNRSIEFPRGRVL
GGSSSINAMSYTRGAKDDYDLWGRVTKDERWGWDALWPYMLRNEQWTPPLGGRDPTGQFD
PQYHNTERGKTVVSLPQDEETEYDRRALRKIELDSHQHRDFRFNLDVNSGSPAGLSWNQD
SVGNGERSSAATAYLSREVRERANLRILVDTYATRVLPTTEGSELDIRTVEMTIRGGPGN
PSSDISNSNATRTMTAKKELMLSAGAFNTPHILMNSGIGDENELRVVGVTPIHHLPAVGK
GMSDHPSVRLRWGTTFTPQPLDEAAALLQWQTNRTGPLAKPTDHLYLYYRLPNDSVVFEG
YDDPSPGPTAVHFELPLWAMPMEEPGPVLPGDLILLTPYSRGSVKLRSSNPFDPPLIDVG
YFTHPFDFDAAREGIRIAKQFYEGEAWEGFITHFIGPDPDTLTEEDFEQSVKENTETLSH
PIGTASMSAVDDPLGKGVVDPELRVKGVKGLRIVDAGVIPYVTSGHTQVPVYVLAERAAD
LVRESWEE

Enzyme Prediction     

No EC number prediction in CC1G_13811-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	40	604	3.7e-149	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.73e-100	37	604	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.88e-97	38	603	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.55e-40	458	598	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	9.94e-32	108	366	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.75e-25	38	578	53	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ82895.1|AA3_2	2.80e-123	41	603	36	602
VWO99079.1|AA3_2	2.76e-122	10	603	8	607
ALJ82906.1|AA3_2	8.15e-122	38	603	32	598
VWO99077.1|AA3_2	3.23e-121	10	603	8	609
AAC72747.1|AA3_2|1.1.3.7	3.76e-120	40	603	29	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	3.62e-123	40	603	1	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.85e-122	40	603	2	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.78e-117	40	606	40	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6YS2_AAA	1.05e-55	36	602	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	2.01e-55	36	602	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|V5NDL4|PDH1_AGACM	5.32e-117	16	606	9	594	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1
sp|Q3L245|PDH1_LEUMG	9.16e-117	40	606	40	601	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1
sp|Q3L1D1|PDH1_AGABI	8.03e-116	27	606	30	593	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.89e-115	38	606	38	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|P0DO29|ERIK_HERER	3.65e-115	41	605	34	598	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.064328	0.935651	CS pos: 23-24. Pr: 0.9072

TMHMM  Annotations     

Start	End
7	26