CAZyme Information: CC1G_12262-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_12262-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		58363.78	5.0682

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000008:2039455-2041835(+)

Full Sequence      

MAFRFALLQFVLLAQLLITPACAVIVDSFAALPANTTYDFVIVGGGNSGAVQLVKDTGNP
RPVLAHRLSSNPRWKVLVIEAGPTHESEDAFRTRVPGFTFSLERTIHDWNFTSTPQAGLN
NREVPLFRGHILGGSSSINGMFYTRGSAADYDRWARVTGDKGWSWRRMVPYIKRSEKWTE
PADGHDTTGRYNPSVHGNNGLVSVSIVGYSQAIDDAVIDASAELGGDFSYDVDVNDGNQL
GVGWVQATVGNGERSSAATSYLAPQYANRPNLHILVNHRVTRLVTSGMRKGVPSLRTVQF
APRNSPGSPVMEVTAKKEVILSAGAYGTPQILLLSGVGNPSELQAKGITPVVDLPGVGKN
MTDHPMLIMPWAVGIPGTIVPTPELQEQWLDEWNTSKTGPLTILGINHNAWIRIPPESDI
WNDFEDPSSGEHTPHVEFGIIGGAMQSAPPPVIMSSVIPVQPLSRGSVTLASSDPFADPV
IDSGVLTSPFDMFTFKYGISEMKRFFNASAWQEYNLTLAEVPEDEDDWDEWIRNVA

Enzyme Prediction     

No EC number prediction in CC1G_12262-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	37	535	3.6e-132	0.8767605633802817

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.23e-84	34	534	2	466	choline dehydrogenase; Validated
225186	BetA	7.82e-76	34	533	4	466	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	6.30e-37	120	365	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.28e-24	28	366	46	329	Protein HOTHEAD
398739	GMC_oxred_C	5.55e-09	462	530	1	69	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO99077.1|AA3_2	1.13e-116	32	534	36	541
ALJ82895.1|AA3_2	1.46e-114	32	526	30	523
ALJ82906.1|AA3_2	5.50e-114	21	514	18	504
AAC72747.1|AA3_2|1.1.3.7	7.17e-112	8	514	1	498
AMW87253.1|AA3_2	1.01e-111	8	514	1	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	6.21e-113	38	514	2	470	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.39e-113	38	514	3	471	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.18e-98	32	534	35	530	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	4.68e-56	35	510	3	487	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5HSA_A	1.55e-47	38	492	7	453	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0DO29|ERIK_HERER	5.96e-112	6	519	2	504	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	9.41e-104	32	536	35	530	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|V5NDL4|PDH1_AGACM	1.18e-99	32	526	31	516	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1
sp|Q3L1D1|PDH1_AGABI	4.51e-99	32	533	35	521	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|V5NC32|PDH1_AGAXA	5.29e-99	32	536	35	530	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000310	0.999657	CS pos: 23-24. Pr: 0.9717

TMHMM  Annotations     

There is no transmembrane helices in CC1G_12262-t26_1-p1.