CAZyme Information: CC1G_12261-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_12261-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: pyranose dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		63987.50	6.9100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000008:2036733-2039004(+)

Full Sequence      

MLNISLTSVIFLIQLLTLPVCAVIVDSYRALPKTNYDFVIVGGGNAGAVLAHRLSTNPRW
KVLVIEAGPTHEGVFNSRVPGLVASLQNTIHDWNLTSTPQAGLNNRVLPLARGHILGGSS
SINGQFYTRGSSSDYDRWARVTGDSGWSWKNILPYFKKNEKWAVSADGHDTTGQYDPKVH
GTDGMVSVSVVGAPQTVDAKVIQASKELGGDYAYVLDMNDGNQLGIGWTQLTVGKGERSS
AATTYLAPKYANRRNLHVLVDHRVTKLVNSGKKGNIPSLRTVQFSSRNEPASTLEVTASK
EVILSAGTYGTPQILLLSGVGDSAELRAKNIDVVVNLPSVGKNLTDHPLLPLVWSLGVPG
TVQPTPELQVEWQAEWNASRTGPLTGVGTNHLGWVRIPSDSEIWKEHEDPSSGRHTPHIE
FGFSGMSIYPSPPAMMVPVIIPVQPASRGSVTLASSDPFSDPLIDVGFLSSPFDLFTFKY
GVSSLKRFFDAPAWKEYNLTLVGVPEGEAELEEFIRNTVSSGAHPVGTAAMSSRGAQWGV
VDPDLKLKKAEGVRIVDCSVMTYVPAGHTMAPVYAVAERVSDLIWDTWSRTN

Enzyme Prediction     

No EC number prediction in CC1G_12261-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	585	1.4e-164	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.52e-113	36	584	6	531	choline dehydrogenase; Validated
225186	BetA	2.66e-99	32	584	4	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	7.07e-36	104	348	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.24e-33	445	579	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.30e-27	36	573	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMW87253.1|AA3_2	2.38e-153	31	584	25	589
CFW94146.1|AA3_2	1.34e-152	31	584	25	589
AAF31169.1|AA3_2|1.1.3.7	2.68e-152	31	584	25	589
AAC72747.1|AA3_2|1.1.3.7	1.07e-151	31	584	25	589
BBC20609.1|AA3_2	1.07e-140	22	584	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	3.03e-153	35	584	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.01e-152	35	584	2	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	9.99e-132	35	584	40	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	8.43e-60	34	584	4	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5NCC_A	3.05e-59	23	584	11	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0DO29|ERIK_HERER	5.94e-147	22	584	20	595	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	2.46e-134	35	584	40	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|V5NDL4|PDH1_AGACM	6.65e-133	35	584	36	590	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1
sp|Q3L1D1|PDH1_AGABI	1.02e-131	35	589	40	594	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|Q3L245|PDH1_LEUMG	5.14e-131	35	584	40	597	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.016413	0.983543	CS pos: 22-23. Pr: 0.9561

TMHMM  Annotations     

There is no transmembrane helices in CC1G_12261-t26_1-p1.