CAZyme Information: CC1G_12227-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_12227-t26_1-p1
• CAZy Family: GT21
• CAZyme Description: 1,3-beta-glucanosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	AACS02000007|CGC5	57693.26	4.0034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000007:2323549-2325468(-)

Full Sequence      

MLVSLRAFAALVALISHVAAIPKVTRTGRYLYQEDGTRFYIKGIGYQVQGEVHDHEDNDF
DEPATFEDPLADPDACRRDVPHLTGAGINTLRVYSVDSSLNHDECMNLFSEAGIYTIIDL
STPLNGSIDRIAPDWSTNLLDAYTRTIDAFEKYDNVIAYNVGNEVVTGTTPQAAPYIKAA
ARDTKAYLKSINSDRLVGYAAINGAPDFRHALATFLTCGSEETSIDLYGLNEYSWCGDSS
IQASGYGTLVTEFADYNVAAYFSEYGCNAVTPRIWSEVDALFSSPMSDVWSGGIAFSYFP
ARSAAGEFGMVTISGSTVTESTEFENLKERYNAVTGPNEPSRDSASASTYPTCAATYPGA
STDLPATPNEAACTCLQNALSCRFTPTVADYSDINGELLNVGCSLLGEAGGSCDEIGGNG
TTGTYGRLAGCDPLVKLSYVMSQYYESQDRNPQACSFSGNGTVNDAASPTESAEALASSC
ISNPDATFVPPRPSGTGGSSSGGGSGNNNNNDNDDDAGSANSLDISALVGVASMAVVGIA
SAAWSLL

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	19	333	1.1e-102	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	4.48e-113	13	334	1	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	9.72e-12	380	462	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	4.93e-07	401	472	26	82	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
397119	Glyco_hydro_2_C	4.01e-06	35	208	11	169	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWP01397.1|CBM43|GH72	1.94e-176	20	496	25	508
QRV86270.1|CBM43|GH72	9.81e-166	10	490	107	592
QRW14839.1|CBM43|GH72	1.47e-165	17	546	148	684
QRW00320.1|CBM43|GH72	9.10e-165	17	490	148	627
QRW27240.1|CBM43|GH72	2.41e-164	10	496	9	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.34e-74	29	455	42	466	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	3.68e-74	29	455	42	466	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	3.68e-74	29	455	42	466	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56092|EPD1_CANMA	2.21e-97	21	482	25	471	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|O74137|EPD2_CANMA	4.38e-97	19	475	24	476	Protein EPD2 OS=Candida maltosa OX=5479 GN=EPD2 PE=3 SV=1
sp|P0C956|GEL4_ASPFU	1.42e-94	29	478	45	484	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	1.42e-94	29	478	45	484	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|Q9P378|GAS1_SCHPO	1.31e-93	19	470	19	454	1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999762	CS pos: 20-21. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in CC1G_12227-t26_1-p1.